DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT74F1

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_181912.1 Gene:UGT74F1 / 818988 AraportID:AT2G43840 Length:449 Species:Arabidopsis thaliana


Alignment Length:360 Identity:83/360 - (23%)
Similarity:145/360 - (40%) Gaps:80/360 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IRFDMIMVEASHLDALYGLAEFYNATLLGISCMHMTWHIDYLA----GNLAPSVYE--------- 184
            |.:|..|..|..|...:|||.   |.....||  ...:|:||:    |:|...:.:         
plant   108 IVYDSFMPWALDLAMDFGLAA---APFFTQSC--AVNYINYLSYINNGSLTLPIKDLPLLELQDL 167

  Fly   185 P--ISPNGFALDNTFLSRWSNWIYITEEKLLERLV-FRPAQVRLFKKFFGYPAEKLDELRARFSV 246
            |  ::|.|           |:..|.  |.:|::.. |..|...|...|......: :||.::...
plant   168 PTFVTPTG-----------SHLAYF--EMVLQQFTNFDKADFVLVNSFHDLDLHE-EELLSKVCP 218

  Fly   247 IL-----VNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEHGA-IYFSMGQDIL 305
            :|     |.|.:...:::::  |..::....|.|     .|....:||:...|: :|.:.|.  :
plant   219 VLTIGPTVPSMYLDQQIKSD--NDYDLNLFDLKE-----AALCTDWLDKRPEGSVVYIAFGS--M 274

  Fly   306 IKYLPENMQKQLLLVFLQMKQRVIWKSELSML-------ANKSENIYVMDKVPQRMVLAHPNLRL 363
            .|...|.|::....:.......|:..||.|.|       .:|.::: |:...||..||::..:..
plant   275 AKLSSEQMEEIASAISNFSYLWVVRASEESKLPPGFLETVDKDKSL-VLKWSPQLQVLSNKAIGC 338

  Fly   364 FITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQ-------------LAGMAKVLDPNDLNA 415
            |:||.|..|.||.:..||||:.:|.:.||..|...:|             .:|:.|        .
plant   339 FMTHCGWNSTMEGLSLGVPMVAMPQWTDQPMNAKYIQDVWKVGVRVKAEKESGICK--------R 395

  Fly   416 DTLIETIKELLENPSYAQRAKEMAASFRDRPMSPL 450
            :.:..:|||::|... ::..||.|..:||..:..|
plant   396 EEIEFSIKEVMEGEK-SKEMKENAGKWRDLAVKSL 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 83/360 (23%)
UGT74F1NP_181912.1 PLN02173 1..449 CDD:177830 83/360 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.