DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT71C1

DIOPT Version :10

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_180536.1 Gene:UGT71C1 / 817525 AraportID:AT2G29750 Length:481 Species:Arabidopsis thaliana


Alignment Length:114 Identity:27/114 - (23%)
Similarity:37/114 - (32%) Gaps:39/114 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 FNKP------LTTEYA-------SNADIGTG---------GGVSEKEQRGTSPPTPLARTGRKAP 199
            |.||      |...||       .|.|.||.         .|:....::.|      |..|:|..
plant     4 FMKPGKVVLVLAGRYAGRKAVIVKNVDDGTSDRQYSHALVAGIDRYPRKVT------ATMGKKRI 62

  Fly   200 APPAP----------NTAAPTVHSPTVPDIGKLSPSADPTADGPVSRKA 238
            |..:.          |...||.:|..:| :.|...:.|...|..:.|||
plant    63 AKRSKIKSFVKVYNYNHLMPTRYSVDIP-LDKAVVNKDVFRDPALKRKA 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 Glycosyltransferase_GTB-type 24..464 CDD:471961 27/114 (24%)
UGT71C1NP_180536.1 PLN02167 4..478 CDD:215112 27/114 (24%)

Return to query results.
Submit another query.