DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT73B4

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_179151.2 Gene:UGT73B4 / 816041 AraportID:AT2G15490 Length:484 Species:Arabidopsis thaliana


Alignment Length:508 Identity:98/508 - (19%)
Similarity:175/508 - (34%) Gaps:164/508 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FPYRIPSPFQMVRPLIKALVERGHKVTMV-TPADYPAKI----------------DGVRHIRVPM 79
            ||:........:..:.|....||.|.|:: ||.:  |||                .|::.:..|.
plant    11 FPFMAHGHMIPLLDMAKLFARRGAKSTLLTTPIN--AKILEKPIEAFKVQNPDLEIGIKILNFPC 73

  Fly    80 L----------NQLMQNLMKNDQF----------------FDALGDKWREGVLVSTIFYNVSHAI 118
            :          ...:.:..|:|.|                .::..:..:...||:.:|:..:...
plant    74 VELGLPEGCENRDFINSYQKSDSFDLFLKFLFSTKYMKQQLESFIETTKPSALVADMFFPWATES 138

  Fly   119 LNNNGVQMLMRDKSIRFDMIMVEASHLDALYGLAEFYNATLLGISCMH-MTWHIDY--LAGNLAP 180
            ....||..|:                         |:..:...:.|.: |..|..:  :|.:..|
plant   139 AEKIGVPRLV-------------------------FHGTSSFALCCSYNMRIHKPHKKVASSSTP 178

  Fly   181 SVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFGYPAEKLDELRARFS 245
            .|. |..|..              |.|||::         |.|...:..||...:::.|......
plant   179 FVI-PGLPGD--------------IVITEDQ---------ANVTNEETPFGKFWKEVRESETSSF 219

  Fly   246 VILVNSHFSM-------------------GRVRANVPNIIEVAG----VHLSEPPEPCGAELQKY 287
            .:||||.:.:                   |.:..:...|.|.||    .::.|      .|..|:
plant   220 GVLVNSFYELESSYADFYRSFVAKKAWHIGPLSLSNRGIAEKAGRGKKANIDE------QECLKW 278

  Fly   288 LDEAEHGA-IYFSMGQDILIKYLPENMQKQLLLVFLQMK---QRVIW---KSELSM--------- 336
            ||....|: :|.|.|..   ..||   .:|||.:...::   |..||   |:|..:         
plant   279 LDSKTPGSVVYLSFGSG---TGLP---NEQLLEIAFGLEGSGQNFIWVVSKNENQVGTGENEDWL 337

  Fly   337 -----LANKSENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNN- 395
                 ..||.:.:.:....||.::|.|..:..|:||.|..|.:|.|..|:||:..|:..:||.| 
plant   338 PKGFEERNKGKGLIIRGWAPQVLILDHKAIGGFVTHCGWNSTLEGIAAGLPMVTWPMGAEQFYNE 402

  Fly   396 -----IHRVQL-AGMAKVLDPNDLNADTLIE-TIKELLENPSYAQ---RAKEM 438
                 :.|:.: .|..:::....|.:...:| .::|::......:   ||||:
plant   403 KLLTKVLRIGVNVGATELVKKGKLISRAQVEKAVREVIGGEKAEERRLRAKEL 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 98/508 (19%)
UGT73B4NP_179151.2 PLN03007 1..484 CDD:178584 98/508 (19%)
YjiC 7..465 CDD:224732 98/508 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.