DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT73B5

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:438 Identity:87/438 - (19%)
Similarity:149/438 - (34%) Gaps:103/438 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 ELGQAANILGVFPYRIPSPFQMVRPLIKALVERGHKVTMV-TPADYPAKI--------------- 69
            |:.:..:|| .||:........:..:.|....||.|.|:: ||.:  |||               
plant     4 EVSERIHIL-FFPFMAQGHMIPILDMAKLFSRRGAKSTLLTTPIN--AKIFEKPIEAFKNQNPDL 65

  Fly    70 -DGVRHIRVPMLNQLMQNLMKNDQFFDALGDKWREGVLVSTIFYNVSHAILNNNGVQMLMRDKSI 133
             .|::....|.:...:....:|..|.::. .|...|.|.....::..:............:..::
plant    66 EIGIKIFNFPCVELGLPEGCENADFINSY-QKSDSGDLFLKFLFSTKYMKQQLESFIETTKPSAL 129

  Fly   134 RFDMIMVEASHLDALYGLAE--FYNATLLGISCMH-MTWHIDY--LAGNLAPSVYEPISPNGFAL 193
            ..||....|:......|:..  |:..:...:.|.: |..|..:  :|.:..|.|. |..|..   
plant   130 VADMFFPWATESAEKLGVPRLVFHGTSFFSLCCSYNMRIHKPHKKVATSSTPFVI-PGLPGD--- 190

  Fly   194 DNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFGYPAEKLDELRARFSVILVNSHFSMGRV 258
                       |.|||::         |.|...:...|...:::.|.......:||||.:.:...
plant   191 -----------IVITEDQ---------ANVAKEETPMGKFMKEVRESETNSFGVLVNSFYELESA 235

  Fly   259 RAN-VPNIIEVAGVH---LSEPPEPCG-------------AELQKYLDEAEHGA-IYFSMGQDIL 305
            .|: ..:.:.....|   ||......|             .|..|:||....|: :|.|.|..  
plant   236 YADFYRSFVAKRAWHIGPLSLSNRELGEKARRGKKANIDEQECLKWLDSKTPGSVVYLSFGSG-- 298

  Fly   306 IKYLPENMQKQLLLVFLQMK---QRVIWKSELSMLANKSEN--------------------IYVM 347
                ......|||.:...::   |..||      :..|:||                    :.:.
plant   299 ----TNFTNDQLLEIAFGLEGSGQSFIW------VVRKNENQGDNEEWLPEGFKERTTGKGLIIP 353

  Fly   348 DKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNN 395
            ...||.::|.|..:..|:||.|..|.:|.|..|:||:..|:..:||.|
plant   354 GWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 86/435 (20%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 87/438 (20%)
MGT 14..456 CDD:273616 84/427 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.