DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT2B10

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_001066.1 Gene:UGT2B10 / 7365 HGNCID:12544 Length:528 Species:Homo sapiens


Alignment Length:537 Identity:134/537 - (24%)
Similarity:259/537 - (48%) Gaps:57/537 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLHLNLYLELGQAANILGVFPYRIPSPFQMVRPLIKALVERGHKVTMVT--------PAD---- 64
            ||:.|:.|...|....:| |:.... |.:..::.::|.||:|||:||::.        |.|    
Human     9 LLIQLSFYFSSGSCGKVL-VWAAEY-SLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTL 71

  Fly    65 ----YPAKIDGVRHIRVPMLNQLMQNL--MKNDQFFDALGDKWREGVLVSTIFYNVSHAILNNNG 123
                ||..:.......:.|  ||::.|  ::.|.|:.....:......::.|..|....:::|. 
Human    72 KLEVYPTSLTKTEFENIIM--QLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNK- 133

  Fly   124 VQMLMRDKSIRFDMIMVEASHLDALYGLAEFYNATLLGISCMHMTWHID-YLAGNLAPSVYEPIS 187
             :::.:.:..|||::..:| :|.....|||.:|...:........:..: :..|.:.|..|.|:.
Human   134 -KLMKKLQESRFDIVFADA-YLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVV 196

  Fly   188 PNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFF----GYPAEKLDELRARFSVIL 248
            .:..:...||:.|..|.:|:    |.....|:...::.:.:|:    |.|. .|.|...:..:.|
Human   197 MSKLSDQMTFMERVKNMLYV----LYFDFWFQIFNMKKWDQFYSEVLGRPT-TLSETMRKADIWL 256

  Fly   249 VNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEA-EHGAIYFSMGQDILIKYLPEN 312
            :.:.::.......:||:..|.|:| .:|.:|...|:::::..: |:|.:.||:|.  ::..:.|.
Human   257 MRNSWNFKFPHPFLPNVDFVGGLH-CKPAKPLPKEMEEFVQSSGENGVVVFSLGS--MVSNMTEE 318

  Fly   313 MQKQLLLVFLQMKQRVIWKSELSMLANKSE----NIYVMDKVPQRMVLAHPNLRLFITHGGLQSV 373
            ....:.....::.|:|:|:.:    .||.:    |..:...:||..:|.||..|.||||||...:
Human   319 RANVIATALAKIPQKVLWRFD----GNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGI 379

  Fly   374 MEAIDNGVPMLGLPLFFDQFNNIHRVQLAGMAKVLDPNDLNADTLIETIKELLENPSYAQRAKEM 438
            .|||.:|:||:|:||||||.:||..::..|.|..:|.|.:::..|:..:|.::.:|||.:...::
Human   380 YEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKL 444

  Fly   439 AASFRDRPMSPLDTAIWWTEYALRNRDTSHMRLNVEEIPLMRYYRLDSILTFGVRLGCVCGSL-- 501
            :....|:|:.|||.|::|.|:.:|::...|:|:....:...:|:.||.|   |..|.||...|  
Human   445 SRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVI---GFLLACVATVLFI 506

  Fly   502 -----IFLGWRLYQKNR 513
                 :|..|:..:|.:
Human   507 ITKCCLFCFWKFARKGK 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 115/467 (25%)
UGT2B10NP_001066.1 UDPGT 23..524 CDD:278624 129/523 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150493
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.