DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and Ugt2a3

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_082370.2 Gene:Ugt2a3 / 72094 MGIID:1919344 Length:534 Species:Mus musculus


Alignment Length:523 Identity:126/523 - (24%)
Similarity:240/523 - (45%) Gaps:85/523 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VRPLIKALVERGHKVTMVTPADYPA-KIDGVRHI-----RVPMLNQL---------MQNLMKN-- 90
            ::.:::.|..|||:||::   .||: .||..:.|     .:|:|.::         :.||..|  
Mouse    39 LKTILEELGARGHEVTVL---KYPSIIIDQSKRIPLHFENIPLLYEIETAENRLNEIANLAVNVI 100

  Fly    91 -------------DQFFDALGDKWREGVLVSTIFYNVSHAILNNNGVQMLMRDKSIRFDMIMVEA 142
                         |.|....||           |.::..::|.|......:||  .::|::::  
Mouse   101 PNLSLWEAAKTLQDFFLQVTGD-----------FESICRSVLYNQKFMDKLRD--AQYDVVVI-- 150

  Fly   143 SHLDALYGLAEFYNATLLGISCMH-----MTWHIDYLAGNL-APSVYEPISPNGFALDNTFLSRW 201
               |.:....|.. |.:|.|..::     |.::::...|.| .|..|.|:..:....:.||..|.
Mouse   151 ---DPVVPCGELV-AEVLQIPFVYTLRFSMGYYMEKHCGQLPIPLSYVPVVMSELTDNMTFTERV 211

  Fly   202 SNWIYITEEKLLERLVFRPAQVRLFKKFF----GYPAEKLDELRARFSVILVNSHFSMGRVRANV 262
            .|.::    .||.....:......:.:|:    |.|......: .:..:.|:.:::.:...|..:
Mouse   212 KNMMF----SLLFEYWLQQYDFAFWDQFYSETLGRPTTFCKTV-GKADIWLIRTYWDVEFPRPYL 271

  Fly   263 PNIIEVAGVHLSEPPEPCGAELQKYLDEA-EHGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQ 326
            ||...|.|:| .:|.:|...|:::::..: |||.:.||:|.  ::|.|.|.....:..|..|:.|
Mouse   272 PNFEFVGGLH-CKPAKPLPKEMEEFVQSSGEHGVVVFSLGS--MVKNLTEEKANLIASVLAQIPQ 333

  Fly   327 RVIWKSELSMLANKSENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFD 391
            :|:|:......|....|..:.:.:||..:|.||..:.||||||...:.|||.:||||:|:|:..|
Mouse   334 KVLWRYSGKKPATLGSNTRLFNWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMLGD 398

  Fly   392 QFNNIHRVQLAGMAKVLDPNDLNADTLIETIKELLENPSYAQRAKEMAASFRDRPMSPLDTAIWW 456
            |.:||..::..|.|..:..:.:.:..|:..::.::..|||.:.|..::....|:|:.|||.|::|
Mouse   399 QPHNIAHMEAKGAALKVSISTMTSTDLLSAVRAVINEPSYKENAMRLSRIHHDQPVKPLDRAVFW 463

  Fly   457 TEYALRNRDTSHMRLNVEEIPLMRYYRLDSI---------LTFGVRLGCVCGSLIFLGWRLYQKN 512
            .|:.:|::...|:|:...::...:|:.||.|         |||.:...|     :|:..:||.|.
Mouse   464 IEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLLCVVTLTFIITKFC-----LFVCQKLYMKE 523

  Fly   513 RNR 515
            ..:
Mouse   524 SKK 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 112/461 (24%)
Ugt2a3NP_082370.2 UDPGT 25..526 CDD:278624 126/521 (24%)
egt <268..507 CDD:223071 73/241 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840283
Domainoid 1 1.000 259 1.000 Domainoid score I1975
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 272 1.000 Inparanoid score I2975
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.690

Return to query results.
Submit another query.