DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT2B28

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_444267.1 Gene:UGT2B28 / 54490 HGNCID:13479 Length:529 Species:Homo sapiens


Alignment Length:557 Identity:141/557 - (25%)
Similarity:256/557 - (45%) Gaps:87/557 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLAFGLLLHLNLYLELGQAANIL---GVFPYRIPSPFQMVRPLIKALVERGHKVTMVT------- 61
            |.:..||:||..|...|....:|   |.:     |.:..::.::|.||:|||:||::.       
Human     5 WTSVLLLIHLGCYFSSGSCGKVLVWTGEY-----SHWMNMKTILKELVQRGHEVTVLASSASILF 64

  Fly    62 -PAD--------YPAKIDGVRHIRVPMLNQLMQNL-----MKNDQFFDALGDK----WREGVLVS 108
             |.|        ||..:     .:....|.:||.:     ::.|.|:.....:    |.    ..
Human    65 DPNDAFTLKLEVYPTSL-----TKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWE----FH 120

  Fly   109 TIFYNVSHAILNNNGVQMLMRDKSIRFDMIMVEASHLDALYGLAEFYNATLLGIS-----CMHMT 168
            .||.|....:::|..|...:::.  |||:|..     ||.:...|.. |.||.|.     |....
Human   121 DIFRNFCKDVVSNKKVMKKLQES--RFDIIFA-----DAFFPCGELL-AALLNIPFVYSLCFTPG 177

  Fly   169 WHIDYLAGNLA-PSVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFF-- 230
            :.|:..:|.|. |..|.|:..:..:...||:.|..|.||:    |.....|:...::.:.:|:  
Human   178 YTIERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYV----LYFDFWFQMCDMKKWDQFYSE 238

  Fly   231 --GYPAEKLDELRARFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEA-E 292
              |.|. .|.|...:..:.|:.:.:|.......:|||..|.|:| .:|.:|...|:::::..: |
Human   239 VLGRPT-TLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLH-CKPAKPLPKEMEEFVQSSGE 301

  Fly   293 HGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQRVIWKSELSMLANKSE----NIYVMDKVPQR 353
            :|.:.||:|.  :|..:.......:.....::.|:|:|:.:    .||.:    |..:...:||.
Human   302 NGVVVFSLGS--VISNMTAERANVIATALAKIPQKVLWRFD----GNKPDALGLNTRLYKWIPQN 360

  Fly   354 MVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLAGMAKVLDPNDLNADTL 418
            .:|..|..|.||||||...:.|||.:|:||:|:|||:||.:||..::..|.|..||.:.:::..|
Human   361 DLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTMSSTDL 425

  Fly   419 IETIKELLENPSYAQRAKEMAASFRDRPMSPLDTAIWWTEYALRNRDTSHMRLNVEEIPLMRYYR 483
            :..:|.::.:|||.:...:::....|:|:.||..|::|.|:.:.::...|:|:...::...:|:.
Human   426 LNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHS 490

  Fly   484 LDSILTFGVRLGCVCGSL-------IFLGWRLYQKNR 513
            ||.|   |..|.||...:       :|..|:..:|.:
Human   491 LDVI---GFLLACVATVIFVVTKFCLFCFWKFARKGK 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 121/482 (25%)
UGT2B28NP_444267.1 UDPGT 24..525 CDD:278624 134/538 (25%)
egt <269..506 CDD:223071 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150495
Domainoid 1 1.000 260 1.000 Domainoid score I1978
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.690

Return to query results.
Submit another query.