DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:160 Identity:33/160 - (20%)
Similarity:69/160 - (43%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MKNDQFFDALGDKWREGVLVSTIFYNVSHAILNNNGVQMLMRDKSIRFDMIMVEA--SHLDALYG 150
            |:||:..|.     .....:|.||.:....:|.:.  :::.|.::..||:.:.|.  :..:||:.
 Worm     1 MENDRGVDQ-----PHAPAMSAIFASQCRKVLEDK--ELIERLRAENFDLAITEPFDTCANALFE 58

  Fly   151 LAEFYNATLLGISCMHMTWHIDYLAGN-LAPSVYEPISPNGFALDNTFLSRWSN----------W 204
            ..:. .|.:..:||..:. |:....|. :||| |.|.:.:......|...|:.|          :
 Worm    59 AIKI-RAHVAVLSCSRLD-HVSKAIGQPIAPS-YLPGTQSTHGERMTIWQRFMNILHFLMGDFLF 120

  Fly   205 IYITEE--KLLERLV-----FRPAQVRLFK 227
            .||.:|  |:.:.::     :|.:.:.|::
 Worm   121 SYIGDEDFKVAKEIIPGVRSWRVSGLELYR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 33/160 (21%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.