DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT72B3

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001322549.1 Gene:UGT72B3 / 837503 AraportID:AT1G01420 Length:484 Species:Arabidopsis thaliana


Alignment Length:266 Identity:53/266 - (19%)
Similarity:102/266 - (38%) Gaps:70/266 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEVGGLHLSEP---------------- 274
            |:..::.::..|...    :|:||...:      .||.|::    :.||                
plant   198 KWLLHNVKRFKEAEG----ILVNSFVDL------EPNTIKI----VQEPAPDKPPVYLIGPLVNS 248

  Fly   275 ----PEPSDE-ELQKFLDKADHG-VIYFSMGNDILIKFLPENIQELLLQTFATLNESIIW----- 328
                .:.:|| :...:||....| |:|.|.|:...:.|  |...||.| ..|...:..:|     
plant   249 GSHDADVNDEYKCLNWLDNQPFGSVLYVSFGSGGTLTF--EQFIELAL-GLAESGKRFLWVIRSP 310

  Fly   329 --------------KSELLYMPD------KSDNVYVVEQAPQRHILNHPNVRLFITNGGLLSVIE 373
                          .....::|.      |...:.|...|||..||.|.::..|:|:.|..|.:|
plant   311 SGIASSSYFNPQSRNDPFSFLPQGFLDRTKEKGLVVGSWAPQAQILTHTSIGGFLTHCGWNSSLE 375

  Fly   374 AVDSGVPMLGLPMFFDQFGNMRWVQLSG---MAEVMDINSLNKDTLTETIKHML---ANNSYYLK 432
            ::.:|||::..|::.:|..|...:...|   .|.:.:...:.::.:...:|.::   ..|:...|
plant   376 SIVNGVPLIAWPLYAEQKMNALLLVDVGAALRARLGEDGVVGREEVARVVKGLIEGEEGNAVRKK 440

  Fly   433 AKEISQ 438
            .||:.:
plant   441 MKELKE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 53/266 (20%)
UDPGT 41..511 CDD:278624 53/266 (20%)
UGT72B3NP_001322549.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.