DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT71C4

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_563784.2 Gene:UGT71C4 / 837236 AraportID:AT1G07250 Length:479 Species:Arabidopsis thaliana


Alignment Length:238 Identity:47/238 - (19%)
Similarity:89/238 - (37%) Gaps:63/238 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 PNIIEVGG-LHLSEPPEPSDEELQK------FLDKADHGVIYFSMGNDILIKFLPENIQELLLQT 318
            |.:..||. |.|.:...|::|.:.:      ..|:.:..|::...|:       ..::.|..::.
plant   245 PPVYPVGPILSLKDRASPNEEAVDRDQIVGWLDDQPESSVVFLCFGS-------RGSVDEPQVKE 302

  Fly   319 FATLNESI----IWK-----------SELL---YMPDKSDNVYVVEQAPQRHILNHPNVRLFITN 365
            .|...|.:    :|.           :::|   :|...:....|...|||..:|.|..:..|:::
plant   303 IARALELVGCRFLWSIRTSGDVETNPNDVLPEGFMGRVAGRGLVCGWAPQVEVLAHKAIGGFVSH 367

  Fly   366 GGLLSVIEAVDSGVPMLGLPMFFDQFGN---------------MRWVQLSGMAEVMD-----INS 410
            .|..|.:|::..|||:...||:.:|..|               |.:|...|.....|     :.|
plant   368 CGWNSTLESLWFGVPVATWPMYAEQQLNAFTLVKELGLAVDLRMDYVSSRGGLVTCDEIARAVRS 432

  Fly   411 L--NKDTLTETIKHML---------ANNSYYLKAKEISQFFKD 442
            |  ..|...:.:|.|.         ..:|....|:.|::.|:|
plant   433 LMDGGDEKRKKVKEMADAARKALMDGGSSSLATARFIAELFED 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 47/238 (20%)
UDPGT 41..511 CDD:278624 47/238 (20%)
UGT71C4NP_563784.2 PLN02167 2..477 CDD:215112 47/238 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.