DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and AT1G06000

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_563756.1 Gene:AT1G06000 / 837109 AraportID:AT1G06000 Length:435 Species:Arabidopsis thaliana


Alignment Length:498 Identity:106/498 - (21%)
Similarity:178/498 - (35%) Gaps:175/498 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VRTLATRGHNVTLITPIG----MPNDIEGVRHIRVAQLNERIKEMLESDQVLDFMINKWTESALT 105
            :|:|.:..|..|||.|..    :|:.:|.::.:.:    |.|..|.                   
plant    54 LRSLHSPEHFKTLILPFPSHPCIPSGVESLQQLPL----EAIVHMF------------------- 95

  Fly   106 AKALFNASNDILSDPGVQRMLHDKSESFDLIIMEPSSL-DALYG---LVEFYNA-----TLMGLS 161
                     |.||      .|||....| |....||.| ||:.|   |..:.|.     ::..:|
plant    96 ---------DALS------RLHDPLVDF-LSRQPPSDLPDAILGSSFLSPWINKVADAFSIKSIS 144

  Fly   162 SIRINWHTYELA-GNPAPSIYEPISPVGFSLETSLFSRVYNWIHIMEEKLVNYLILRPAQLHLFQ 225
            .:.||.|:..:. .....|.:..:.    :..|..:..|.|..:.:|.:.|              
plant   145 FLPINAHSISVMWAQEDRSFFNDLE----TATTESYGLVINSFYDLEPEFV-------------- 191

  Fly   226 KFFGYSAQKMNELRSRFSLMLINSH--YSMGKV---RANAPNIIEVGGLHLSEPPEPSDEELQKF 285
                      ..:::||    :|.|  :::|.:   :|.    ::.|| ..|.||    .::..:
plant   192 ----------ETVKTRF----LNHHRIWTVGPLLPFKAG----VDRGG-QSSIPP----AKVSAW 233

  Fly   286 LDKA--DHGVIYFSMGNDILIKFLPENIQELLLQTFATLNES---IIWK-SELLYMPDKSDNVYV 344
            ||..  |:.|:|...|:.  |:...|....|.    |.|.:|   .||. .:.....:.|||  .
plant   234 LDSCPEDNSVVYVGFGSQ--IRLTAEQTAALA----AALEKSSVRFIWAVRDAAKKVNSSDN--S 290

  Fly   345 VEQ---------------------APQRHILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFF 388
            ||:                     |||..||.|..|..::|:.|..||:|.:..||.:|..||..
plant   291 VEEDVIPAGFEERVKEKGLVIRGWAPQTMILEHRAVGSYLTHLGWGSVLEGMVGGVMLLAWPMQA 355

  Fly   389 DQFGNMRWV--QLSGMAEVMDINSLNKDTLTETIK--HMLANNSYYLKAKEISQFFKDRPMSPLD 449
            |.|.|...:  :|.....|.:    |:|::.::.|  .:||.:     |:|      |.|     
plant   356 DHFFNTTLIVDKLRAAVRVGE----NRDSVPDSDKLARILAES-----ARE------DLP----- 400

  Fly   450 TAVWWTEYALRNRNITRMRLNLEEIPLIE-----YYRIDSILA 487
                        ..:|.|:|..:.:..|:     |..:|.::|
plant   401 ------------ERVTLMKLREKAMEAIKEGGSSYKNLDELVA 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 99/466 (21%)
UDPGT 41..511 CDD:278624 106/498 (21%)
AT1G06000NP_563756.1 Glycosyltransferase_GTB-type 8..430 CDD:385653 105/495 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.