DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:365 Identity:82/365 - (22%)
Similarity:131/365 - (35%) Gaps:99/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 WTESALTAKALFNASNDILSDP-GVQRMLHDKSESFDLIIMEPSSLDALYGLVEFYNATLMGLSS 162
            ||..|.:..|  :...|::.:. ||:.:.....|:..:|                     .|:..
plant   144 WTAGANSLSA--HLYTDLIRETIGVKEVGERMEETIGVI---------------------SGMEK 185

  Fly   163 IRINWHTYELAGNPAPSIYEPISPVG--FSLETSLFSRVYNWIHIMEEKLVNYLILRPAQLHLFQ 225
            ||:.                 .:|.|  |....|:||::   :|.|.      |.|..|......
plant   186 IRVK-----------------DTPEGVVFGNLDSVFSKM---LHQMG------LALPRATAVFIN 224

  Fly   226 KFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEVGGL-----HLSEPPEPSDEELQKF 285
            .|........|.|||||...|               ||..:|.|     .|.:.|......::| 
plant   225 SFEDLDPTLTNNLRSRFKRYL---------------NIGPLGLLSSTLQQLVQDPHGCLAWMEK- 273

  Fly   286 LDKADHGVIYFSMGNDILIKFLPENIQELLLQTFATLNESIIW---KSELLYMP----DKS-DNV 342
              ::...|.|.|.|.   :...|......:.:...:.....:|   :..|:.:|    |:: :..
plant   274 --RSSGSVAYISFGT---VMTPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQG 333

  Fly   343 YVVEQAPQRHILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQL---SGMAE 404
            .||..|||..:|.|....:|:|:.|..||:|:|..||||:..|.|.||..|.|.|::   .||..
plant   334 IVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTI 398

  Fly   405 VMDI-------NSLNKDTLTETIKHMLANNSYYLKAKEIS 437
            :..:       ..|:|..:.:..|.|..|..   |.||::
plant   399 INGVFTKDGFEKCLDKVLVQDDGKKMKCNAK---KLKELA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 82/365 (22%)
UDPGT 41..511 CDD:278624 82/365 (22%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 82/365 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.