DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:471 Identity:98/471 - (20%)
Similarity:188/471 - (39%) Gaps:108/471 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IFPY-RHISPFFVMQPLVRTLA---------TRGHNVTLITPIGMPNDIEGVRHIRVAQLNERIK 83
            :||: .|.:|...:...:.|.|         |...|.:|::     :||.  .:|||..:::.:.
plant    17 VFPFGTHAAPLLAVTCRLATAAPSTVFSFFSTARSNSSLLS-----SDIP--TNIRVHNVDDGVP 74

  Fly    84 EMLESDQVLDFMINKWTESALTAKALF-NASNDIL------SDPGVQR----MLHDKSESFDLII 137
            |        .|::   |.:...|..|| .|:.:|.      ::..|.|    :|.|   :|..:.
plant    75 E--------GFVL---TGNPQHAVELFLEAAPEIFRREIKAAETEVGRKFKCILTD---AFLWLA 125

  Fly   138 MEPSSLDALYGLVEFYNATLMGLSSIRINWHTYELAGNPAPSIYEPISPVGFSLETSLFSRVYNW 202
            .|.::.:.....|.:|..   |.:|:..:.:|..:..|..      :..||..:|.::     .:
plant   126 AETAAAEMKASWVAYYGG---GATSLTAHLYTDAIRENVG------VKEVGERMEETI-----GF 176

  Fly   203 IHIMEEKLVNYLILRPAQLHL----FQKFFGYSAQKMNELRSRFSLMLINSHYSM-----GKVRA 258
            |..||:     :.::..|..:    ....|..:..:|.....|.:.:.|||...:     ...|:
plant   177 ISGMEK-----IRVKDTQEGVVFGNLDSVFSKTLHQMGLALPRATAVFINSFEELDPTFTNDFRS 236

  Fly   259 NAPNIIEVGGLH-LSEPPEPSDEELQKFLDKADHG------------VIYFSMGNDILIKFLPEN 310
            .....:.:|.|. ||.|.:.|.      |....||            |.|.:.|.   :...|..
plant   237 EFKRYLNIGPLALLSSPSQTST------LVHDPHGCLAWIEKRSTASVAYIAFGR---VATPPPV 292

  Fly   311 IQELLLQTFATLNESIIW---KSELLYMPD-----KSDNVYVVEQAPQRHILNHPNVRLFITNGG 367
            ....:.|...:.....:|   :.::.::|:     ..:...||..|||..:|||..:.:|:::||
plant   293 ELVAIAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHEAMGVFVSHGG 357

  Fly   368 LLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQLSGMAEV-MDINS--LNKDTLTETIKHMLANN-- 427
            ..||:|:|.:||||:..|:|.|...|.|.|:  .:.|: :.|:|  ..||...|::..:|..:  
plant   358 WNSVLESVSAGVPMICRPIFGDHAINARSVE--AVWEIGVTISSGVFTKDGFEESLDRVLVQDDG 420

  Fly   428 -SYYLKAKEISQFFKD 442
             ...:.||::.:..::
plant   421 KKMKVNAKKLEELAQE 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 98/471 (21%)
UDPGT 41..511 CDD:278624 94/458 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 98/471 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.