DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and AT5G05890

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_196208.1 Gene:AT5G05890 / 830474 AraportID:AT5G05890 Length:455 Species:Arabidopsis thaliana


Alignment Length:220 Identity:60/220 - (27%)
Similarity:89/220 - (40%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 HYSMGKVRAN--APNIIEVGGLHLSEPPEPS-----DEELQKFLDK-ADHGVIYFSMGNDILIK- 305
            |.|:.:.|.:  .| |..:|..|...|...|     ||....:||| .|..|||.|.|:.:.|. 
plant   220 HDSVSQAREDFKIP-IFGIGPSHSHFPATSSSLSTPDETCIPWLDKQEDKSVIYVSYGSIVTISE 283

  Fly   306 --------FLPENIQELLL----------QTFATLNESIIWKSELLYMPDKSDNVYVVEQAPQRH 352
                    .|..:.|..||          :...|:.|.|:.|     :.:|..   :|:.|||:.
plant   284 SDLIEIAWGLRNSDQPFLLVVRVGSVRGREWIETIPEEIMEK-----LNEKGK---IVKWAPQQD 340

  Fly   353 ILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFFDQFGNMRWV--------QLSGMAEVMDIN 409
            :|.|..:..|:|:.|..|.:|:|...|||:.||..:||..|.|:|        .|....|..:|.
plant   341 VLKHRAIGGFLTHNGWSSTVESVCEAVPMICLPFRWDQMLNARFVSDVWMVGINLEDRVERNEIE 405

  Fly   410 SLNKDTLTETIKHMLANNSYYLKAK 434
            ...:..|.|.....:.....:||.|
plant   406 GAIRRLLVEPEGEAIRERIEHLKEK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 60/220 (27%)
UDPGT 41..511 CDD:278624 60/220 (27%)
AT5G05890NP_196208.1 Glycosyltransferase_GTB-type 2..455 CDD:385653 60/220 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.