DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT76C1

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:175 Identity:48/175 - (27%)
Similarity:73/175 - (41%) Gaps:32/175 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 IIEVGGLHLSEPPEPS------DEELQKFLD-KADHGVIYFSMGNDILIKFLPENIQELLLQTFA 320
            |..:|..|:.:.|..|      |:....:|| :....|:|.|:|:   |..|.|:....:.....
plant   235 IFPIGPFHIHDVPASSSSLLEPDQSCIPWLDMRETRSVVYVSLGS---IASLNESDFLEIACGLR 296

  Fly   321 TLNESIIWK-----------SELL---YMPDKSDNVYVVEQAPQRHILNHPNVRLFITNGGLLSV 371
            ..|:|.:|.           .|.|   :|........:|..|||..:|.|.....|:|:.|..|.
plant   297 NTNQSFLWVVRPGSVHGRDWIESLPSGFMESLDGKGKIVRWAPQLDVLAHRATGGFLTHNGWNST 361

  Fly   372 IEAVDSGVPMLGLPMFFDQFGNMR-----W---VQLSGMAEVMDI 408
            :|::..||||:.||..:|||.|.|     |   :.|.|..|..:|
plant   362 LESICEGVPMICLPCKWDQFVNARFISEVWRVGIHLEGRIERREI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 48/175 (27%)
UDPGT 41..511 CDD:278624 48/175 (27%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 48/175 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.