DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and AT4G14090

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:421 Identity:100/421 - (23%)
Similarity:169/421 - (40%) Gaps:99/421 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ILGIFPYR-HISPFFVMQPLVRTLATRGHNVTLITPI------GMPNDIEGVRHIRVAQLNERIK 83
            :|..||.: ||:|  .:| |...|...|..||..|.:      |.|...:|   :..|...:...
plant    15 LLVTFPAQGHINP--ALQ-LANRLIHHGATVTYSTAVSAHRRMGEPPSTKG---LSFAWFTDGFD 73

  Fly    84 EMLES--DQVLDFM--INKWTESALTAKALFNASNDILSD-------------PGVQRMLHDKSE 131
            :.|:|  ||.: :|  :.:...:||  :.:..|:.|..::             |.|..:..:...
plant    74 DGLKSFEDQKI-YMSELKRCGSNAL--RDIIKANLDATTETEPITGVIYSVLVPWVSTVAREFHL 135

  Fly   132 SFDLIIMEPSS-LDALYGLVEFYNAT---LMGLSSIRINWHTYELAGNPAPSIYEPISPVGFSLE 192
            ...|:.:||:: ||..|   .::|.:   |..:..|::........|: .||..:|...:..:|.
plant   136 PTTLLWIEPATVLDIYY---YYFNTSYKHLFDVEPIKLPKLPLITTGD-LPSFLQPSKALPSALV 196

  Fly   193 TSLFSRVYNWIHIMEEKLVNYLILRPAQLHLFQKFFGYSAQKMNELRSRFSLMLINSHYSMGKVR 257
            |     :...|..:|.:                     |..|:  |.:.||.:..::..|:.|::
plant   197 T-----LREHIEALETE---------------------SNPKI--LVNTFSALEHDALTSVEKLK 233

  Fly   258 ANAPNIIEVGGLHLSEPP-----EPSDEELQKFLD-KADHGVIYFSMG---NDILIKFLPENIQE 313
                 :|.:|.|..|...     :.|||:..|:|| |.:..|||.|:|   :|     |||...|
plant   234 -----MIPIGPLVSSSEGKTDLFKSSDEDYTKWLDSKLERSVIYISLGTHADD-----LPEKHME 288

  Fly   314 LLLQTFATLNESIIW-----------KSELLYMPDKSDNVYVVEQAPQRHILNHPNVRLFITNGG 367
            .|.......|...:|           |:..|.:...||...||....|..:|.|..|..|:|:.|
plant   289 ALTHGVLATNRPFLWIVREKNPEEKKKNRFLELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCG 353

  Fly   368 LLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQ 398
            ..|.:|:::||||::..|.|.||....:.|:
plant   354 WNSTLESLESGVPVVAFPQFADQCTTAKLVE 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 100/421 (24%)
UDPGT 41..511 CDD:278624 94/405 (23%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 100/421 (24%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 100/421 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.