DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:440 Identity:89/440 - (20%)
Similarity:172/440 - (39%) Gaps:119/440 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 HISPFFVMQPLVRTLATRGHNVTLITPIGMPNDI-EGVRHIRVAQLNERIKEMLESDQV-----L 92
            |::|  :|| |.:.|.::|.::|::.  |..|.: ...:|....|. ..|||.|...:.     :
plant    21 HVTP--LMQ-LGKVLNSKGFSITVVE--GHFNQVSSSSQHFPGFQF-VTIKESLPESEFEKLGGI 79

  Fly    93 DFMI--NKWTESAL---TAKALFNASNDILSDPGVQRMLHDKSESFDLIIMEPSSLDALYGLVEF 152
            :.||  ||.:|::.   .::.|....|||..      :::|:...|                   
plant    80 ESMITLNKTSEASFKDCISQLLLQQGNDIAC------IIYDEYMYF------------------- 119

  Fly   153 YNATLMGLSSIRINWHTYELAGNPAPSIYEPISPVGFSLETSLFS--RVYNWIH--IMEEKLV-- 211
                                .|..|..         ||:.:.:||  ...|::.  .|::|:|  
plant   120 --------------------CGAAAKE---------FSIPSVIFSTQSAANYVSHPDMQDKVVEN 155

  Fly   212 ----NYLILRPAQLHLFQKFFGYSAQKMNELRSRFSLMLIN-------SHYSMGKVRANAPNIIE 265
                .|..|..:.:....:||....:..|:..:  |.::||       |..|..:.:... ::..
plant   156 LYPLRYKDLPTSGMGPLDRFFELCREVANKRTA--SAVIINTVSCLESSSLSWLEQKVGI-SVYP 217

  Fly   266 VGGLHLSEPPEPS----DEELQKFLDK-ADHGVIYFSMGNDILIKFLPE-NIQELLLQTFATLNE 324
            :|.||:::....|    |....::|:| ....|||.|:|.      |.: ..:|:|..::...|.
plant   218 LGPLHMTDSSPSSLLEEDRSCIEWLNKQKPKSVIYISIGT------LGQMETKEVLEMSWGLCNS 276

  Fly   325 -----------SIIWKSELLYMPDK-----SDNVYVVEQAPQRHILNHPNVRLFITNGGLLSVIE 373
                       ||:..:.:..:|:.     |:..|:|::|||..:|.||.|..|.::.|..|::|
plant   277 NQPFLWVIRAGSILGTNGIESLPEDVNKMVSERGYIVKRAPQIEVLGHPAVGGFWSHCGWNSILE 341

  Fly   374 AVDSGVPMLGLPMFFDQFGNMRWVQLSGMAEVMDINSLNKDTLTETIKHM 423
            ::..||||:..|...:|..|..:::......:.....|.:..:...:|.:
plant   342 SIGEGVPMICKPFHGEQKLNAMYLECVWKIGIQVEGDLERGAVERAVKRL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 89/440 (20%)
UDPGT 41..511 CDD:278624 87/433 (20%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 89/440 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.