DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT84B2

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_179906.1 Gene:UGT84B2 / 816857 AraportID:AT2G23250 Length:438 Species:Arabidopsis thaliana


Alignment Length:355 Identity:78/355 - (21%)
Similarity:133/355 - (37%) Gaps:119/355 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 WHTYELAGNPAPSIYE-------PISPVGFSLETSLFSRVYNWIHIMEEKLVNYLILRPAQLHLF 224
            ::.|.:..||.|.:.:       |..|                  ::|.:.:..|:| |:|    
plant   128 YYRYYMKTNPFPDLEDLNQTVELPALP------------------LLEVRDLPSLML-PSQ---- 169

  Fly   225 QKFFGYSAQKMNELRSRFS-------LMLINSHY--------SMGKVRANAPNIIEVGGL----H 270
                   ...:|.|.:.|:       .:|:||.|        ||..::.    ||.:|.|    .
plant   170 -------GANVNTLMAEFADCLKDVKWVLVNSFYELESEIIESMSDLKP----IIPIGPLVSPFL 223

  Fly   271 LSEPPEPS------DEELQKFLDK-ADHGVIYFSMGNDILIKFLPENIQELLLQTFATLNESIIW 328
            |....|.:      |:...::||| |...|:|.|.|:  ::|.| ||..|.:...........:|
plant   224 LGNDEEKTLDMWKVDDYCMEWLDKQARSSVVYISFGS--ILKSL-ENQVETIATALKNRGVPFLW 285

  Fly   329 KSELLYMPDKSDNVYVVEQ------------APQRHILNHPNVRLFITNGGLLSVIEAVDSGVPM 381
               ::...:|.:||.|:::            ..|..||:|..:..|||:.|..|.||.|.:|||:
plant   286 ---VIRPKEKGENVQVLQEMVKEGKGVVTEWGQQEKILSHMAISCFITHCGWNSTIETVVTGVPV 347

  Fly   382 LGLPMFFDQ----------FG---NMRWVQLSGMAEVMDINSLNKDTLTE------------TIK 421
            :..|.:.||          ||   .|:...:.|..:|.::... .:.:||            .:|
plant   348 VAYPTWIDQPLDARLLVDVFGIGVRMKNDAIDGELKVAEVERC-IEAVTEGPAAADMRRRATELK 411

  Fly   422 H-----MLANNSYYLKAKEISQFFKDRPMS 446
            |     |....|   .|:.:..|..|.|::
plant   412 HAARSAMSPGGS---SAQNLDSFISDIPIT 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 78/355 (22%)
UDPGT 41..511 CDD:278624 78/355 (22%)
UGT84B2NP_179906.1 PLN02210 1..438 CDD:215127 78/353 (22%)
YjiC 8..420 CDD:224732 73/332 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.