DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and AT2G23210

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001318272.1 Gene:AT2G23210 / 816853 AraportID:AT2G23210 Length:287 Species:Arabidopsis thaliana


Alignment Length:264 Identity:58/264 - (21%)
Similarity:95/264 - (35%) Gaps:71/264 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LILRPAQLHL--FQKFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEV----GGLHLS 272
            ::..|.|.||  ..||    |:.:......|:|..|.|...:........:::::    .||...
plant    13 MVALPFQGHLNPMLKF----AKHLARTNLHFTLATIESARDLLSSTDEPHSLVDLVFFSDGLPKD 73

  Fly   273 EP--PEPSDEELQKF----LDKADHGVIYFSMGNDILIKFLP--------ENIQELLLQTFATLN 323
            :|  .||..|.|:|.    ..|...|..:..:   |.:.|.|        .||...:|...|...
plant    74 DPRDHEPLTESLRKVGANNFSKIIEGKRFDCI---ISVPFTPWVPAVAAAHNIPCAILWIEACAG 135

  Fly   324 ESIIWKSELLYM-----PDKSDNVYVVEQAPQRHILNHPNVRLFITNGGLLSVIEAVDSGVPMLG 383
            .|:.::   .||     ||..|                ||.::.:..   |..:|..|  :|.|.
plant   136 FSVYYR---YYMKTNSFPDLED----------------PNQKVELPG---LPFLEVRD--LPTLM 176

  Fly   384 LPMFFDQFGNMRWVQLSGMAEVMDINSLNKDTLTETIKHMLANNSYYLKAKEISQFFKDRPMSPL 448
            ||.....|..:       |||.::        ..:.:|.:|||:.|.|::..|...|..:|:.|:
plant   177 LPSHGAIFNTL-------MAEFVE--------CLKDVKWVLANSFYELESVIIESMFDLKPIIPI 226

  Fly   449 DTAV 452
            ...|
plant   227 GPLV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 58/264 (22%)
UDPGT 41..511 CDD:278624 58/264 (22%)
AT2G23210NP_001318272.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.