DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT2A3

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:XP_011530549.1 Gene:UGT2A3 / 79799 HGNCID:28528 Length:533 Species:Homo sapiens


Alignment Length:528 Identity:116/528 - (21%)
Similarity:236/528 - (44%) Gaps:97/528 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 ISPFFVMQPLVRTLATRGHNVTLITPIGMPNDIEGVRHIRVAQLNERIKEML------------- 86
            :|.:..::.::..|..|||.||::|            |.:.:.::.|....|             
Human    33 MSHWLNVKVILEELIVRGHEVTVLT------------HSKPSLIDYRKPSALKFEVVHMPQDRTE 85

  Fly    87 ESDQVLDFMINKWTESALTAKALFNASNDILSDPGVQRMLHD------------KSESFDLIIME 139
            |::..:|..:|. .....|.:::...::..:...|..:|:.:            :..::|:::::
Human    86 ENEIFVDLALNV-LPGLSTWQSVIKLNDFFVEIRGTLKMMCESFIYNQTLMKKLQETNYDVMLID 149

  Fly   140 P----SSLDALYGLVEFYNATLMGLSSIRINWHTYELAGN--------PAPSIYEPISPVGFSLE 192
            |    ..|.|....|.|       :.::||:     :.||        |||..|.|:...|.:..
Human   150 PVIPCGDLMAELLAVPF-------VLTLRIS-----VGGNMERSCGKLPAPLSYVPVPMTGLTDR 202

  Fly   193 TSLFSRVYNWIHIMEEKLVNYLILRPAQLHLFQKFFGYSAQK---MNELRSRFSLMLINSHYSMG 254
            .:...||.|   .|...|.::.| :....|.:::|:..:..:   :.|...:..:.||.:::...
Human   203 MTFLERVKN---SMLSVLFHFWI-QDYDYHFWEEFYSKALGRPTTLCETVGKAEIWLIRTYWDFE 263

  Fly   255 KVRANAPNIIEVGGLHLSEPPEPSD---------EELQKFLDKA-DHGVIYFSMGNDILIKFLPE 309
            ..:...||...|||||.    :|:.         :|::.|:..: :.|::.||:|:  |.:.:.|
Human   264 FPQPYQPNFEFVGGLHC----KPAKALPKINFYLQEMENFVQSSGEDGIVVFSLGS--LFQNVTE 322

  Fly   310 NIQELLLQTFATLNESIIWKSELLYMPDKSD----NVYVVEQAPQRHILNHPNVRLFITNGGLLS 370
            ....::....|.:.:.::|:    |...|..    |..:.:..||..:|.||..:.|||:||:..
Human   323 EKANIIASALAQIPQKVLWR----YKGKKPSTLGANTRLYDWIPQNDLLGHPKTKAFITHGGMNG 383

  Fly   371 VIEAVDSGVPMLGLPMFFDQFGNMRWVQLSGMAEVMDINSLNKDTLTETIKHMLANNSYYLKAKE 435
            :.||:..||||:|:|:|.||..|:..::..|.|..::..::..:.|...::.::.::||...|..
Human   384 IYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTSEDLLRALRTVITDSSYKENAMR 448

  Fly   436 ISQFFKDRPMSPLDTAVWWTEYALRNRNITRMRLNLEEIPLIEYYRIDSILAFSLRFGLVAASLI 500
            :|:...|:|:.|||.||:|.|:.:|::....:|....::...::|.|| ::.|.|   ...|:.|
Human   449 LSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHDLTWFQHYSID-VIGFLL---ACVATAI 509

  Fly   501 FLVYTLFL 508
            ||....||
Human   510 FLFTKCFL 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 104/480 (22%)
UDPGT 41..511 CDD:278624 115/522 (22%)
UGT2A3XP_011530549.1 UDPGT 24..528 CDD:278624 116/528 (22%)
egt <267..498 CDD:223071 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150231
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.