DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT2B17

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001068.1 Gene:UGT2B17 / 7367 HGNCID:12547 Length:530 Species:Homo sapiens


Alignment Length:545 Identity:126/545 - (23%)
Similarity:246/545 - (45%) Gaps:88/545 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WLTLSLCLLLQ--HDRAQAANILGIFP--YRHISPFFVMQPLVRTLATRGHNVTLITPIGMPNDI 67
            |:::.|.:.|.  ........:| ::|  |.|   :..|:.::..|..|||.|.::|        
Human     5 WMSVFLLMQLSCYFSSGSCGKVL-VWPTEYSH---WINMKTILEELVQRGHEVIVLT-------- 57

  Fly    68 EGVRHIRVAQLNERIK-----EMLESDQVLDF---MINKWTESAL--TAKALFNASNDI---LSD 119
            .....:..|..:..||     ..|..:.:.||   |.::||.|..  |..:.|:...::   .||
Human    58 SSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSD 122

  Fly   120 PGV---------QRMLHDKSES-FDLIIMEPSSLDALYG----LVEFYNATLMGLSSIRIN-WHT 169
            ..:         ::::....|| ||:::     .||:..    |.|..|...  |.|:|.: .:|
Human   123 YNIKLCEDAVLNKKLMRKLQESKFDVLL-----ADAVNPCGELLAELLNIPF--LYSLRFSVGYT 180

  Fly   170 YELAGNP--APSIYEPISPVGFSLETSLFSRVYNWIHIME-------------EKLVNYLILRPA 219
            .|..|..  .|..|.|:.....|.:.....|:.|.|:::.             ::..:.::.||.
Human   181 VEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPT 245

  Fly   220 QLHLFQKFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEVGGLHLSEPPEPSDEELQK 284
            .|.              |...:..:.||.:::.....|...||:..||||| .:|.:|..:|:::
Human   246 TLF--------------ETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLH-CKPAKPLPKEMEE 295

  Fly   285 FLDKA-DHGVIYFSMGNDILIKFLPENIQELLLQTFATLNESIIWKSELLYMPDKSDNVYVVEQA 348
            |:..: ::|::.||:|:  :|..:.|....::....|.:.:.::|:.:.........|..:.:..
Human   296 FVQSSGENGIVVFSLGS--MISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWL 358

  Fly   349 PQRHILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQLSGMAEVMDINSLNK 413
            ||..:|.||..:.|||:||...:.||:..|:||:|:|:|.||..|:..::..|.|..:||.:::.
Human   359 PQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSS 423

  Fly   414 DTLTETIKHMLANNSYYLKAKEISQFFKDRPMSPLDTAVWWTEYALRNRNITRMRLNLEEIPLIE 478
            ..|...:|.::.:..|.....::|:...|:|:.|||.||:|.|:.:|::....:|:....:..|:
Human   424 RDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQ 488

  Fly   479 YYRIDSILAFSLRFGLVAASLIFLV 503
            |:.:| ::||.|   ...|::||::
Human   489 YHSLD-VIAFLL---ACVATMIFMI 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 113/486 (23%)
UDPGT 41..511 CDD:278624 119/507 (23%)
UGT2B17NP_001068.1 UDPGT 24..518 CDD:278624 123/526 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.