DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and UGT2B15

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001067.2 Gene:UGT2B15 / 7366 HGNCID:12546 Length:530 Species:Homo sapiens


Alignment Length:549 Identity:130/549 - (23%)
Similarity:252/549 - (45%) Gaps:76/549 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLRYCWLTLSLCLLLQHDRAQAANILGIFP--YRHISPFFVMQPLVRTLATRGHNVTLITPIGM 63
            |.|::..:.|.:.|...........:| ::|  |.|   :..|:.::..|..|||.||::|  ..
Human     1 MSLKWTSVFLLIQLSCYFSSGSCGKVL-VWPTEYSH---WINMKTILEELVQRGHEVTVLT--SS 59

  Fly    64 PNDIEGVRHIRVAQL----NERIKEMLESD--QVLD---FMINK---WTESALTAK---ALFNAS 113
            .:.:.........:|    ....|..||..  ::||   :.::|   |:..:...:   ..::.|
Human    60 ASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYS 124

  Fly   114 NDILSDPGVQR--MLHDKSESFDLIIMEPSSLDALYG----LVEFYNATLMGLSSIRIN-WHTYE 171
            |.:..|..:.:  |:..:...||:|:     .|||..    |.|.:|...  |.|:|.: .:|:|
Human   125 NKLCKDAVLNKKLMMKLQESKFDVIL-----ADALNPCGELLAELFNIPF--LYSLRFSVGYTFE 182

  Fly   172 LAGNP--APSIYEPISPVGFSLETSLFSRVYNWIHIME-------------EKLVNYLILRPAQL 221
            ..|..  .|..|.|:.....|.:.....|:.|.||::.             ::..:.::.||..|
Human   183 KNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTL 247

  Fly   222 HLFQKFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEVGGLHLSEPPEPSDEELQKFL 286
            .              |...:..:.||.:::.....|...||:..||||| .:|.:|..:|:::|:
Human   248 F--------------ETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLH-CKPAKPLPKEMEEFV 297

  Fly   287 DKA-DHGVIYFSMGNDILIKFLPENIQELLLQTFATLNESIIWKSELLYMPDKSDNVYVVEQAPQ 350
            ..: ::|::.||:|:  :|..:.|....::....|.:.:.::|:.:.........|..:.:..||
Human   298 QSSGENGIVVFSLGS--MISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQ 360

  Fly   351 RHILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQLSGMAEVMDINSLNKDT 415
            ..:|.||..:.|||:||...:.||:..|:||:|:|:|.||..|:..::..|.|..:||.:::...
Human   361 NDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRD 425

  Fly   416 LTETIKHMLANNSYYLKAKEISQFFKDRPMSPLDTAVWWTEYALRNRNITRMRLNLEEIPLIEYY 480
            |...:|.::.:..|.....::|:...|:||.|||.||:|.|:.:|::....:|:....:..|:|:
Human   426 LLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYH 490

  Fly   481 RIDSILAFSLRFGLVAASLIFLV--YTLF 507
            .:| ::||.|   ...|::||::  :.||
Human   491 SLD-VIAFLL---ACVATVIFIITKFCLF 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 114/480 (24%)
UDPGT 41..511 CDD:278624 122/507 (24%)
UGT2B15NP_001067.2 egt 8..508 CDD:223071 125/533 (23%)
UDPGT 24..518 CDD:278624 126/526 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165150282
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 267 1.000 Inparanoid score I3041
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.690

Return to query results.
Submit another query.