DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B1 and Ugt2b10

DIOPT Version :9

Sequence 1:NP_651153.1 Gene:Ugt303B1 / 42775 FlyBaseID:FBgn0039086 Length:519 Species:Drosophila melanogaster
Sequence 2:NP_001178605.1 Gene:Ugt2b10 / 305264 RGDID:1309989 Length:532 Species:Rattus norvegicus


Alignment Length:558 Identity:126/558 - (22%)
Similarity:241/558 - (43%) Gaps:112/558 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TLSLCLLLQHDRAQAANILG--------IFPYRHISPFFVMQPLVRTLATRGHNVTLITP-IGMP 64
            |.||.|||    .|.::..|        ::| ...|.:..::.::..|..:||.||::.| ..:.
  Rat     6 TASLLLLL----LQLSDFFGSGTGGKVLVWP-MEFSHWLNLRVILDELLKKGHEVTVLRPSASLS 65

  Fly    65 NDIEGVRHIR---------VAQLNERIKEMLES-----------DQVLDFMINKWTES----ALT 105
            .:::....|.         :.:::|...|.|..           ...|.|....|.:|    :|.
  Rat    66 YEVDNTSAIEFETYPTSYSLTEVDEFFWESLRKYIYELPKQSFWGYFLMFQELVWVDSDYFESLC 130

  Fly   106 AKALFNASNDILSDPGVQRMLHDKSESFDLIIMEP-----------SSLDALYGLVEFYNATLMG 159
            ...:||.          :.|...::..||:|:.:|           ..:..:|.| .|:..:   
  Rat   131 KDVVFNK----------ELMTKLQNSGFDVILADPFIPCGDLLAEILKIPLVYSL-RFFPGS--- 181

  Fly   160 LSSIRINWHTYE--LAGNPAPSIYEPISPVGFSLETSLFSRVYNWIHIM----------EEK--- 209
                     |||  ..|.|.|..|.||:....|...:...|:.:.|:::          |:|   
  Rat   182 ---------TYEKYSGGLPMPPSYVPIAMSELSDRMTFVERMKHMIYVLCFDFWFQAFNEKKWNE 237

  Fly   210 LVNYLILRPAQLHLFQKFFGYSAQKMNELRSRFSLMLINSHYSMGKVRANAPNIIEVGGLHLSEP 274
            |...::.||..|              :|..::..:.||.:::.:.......||...||||| ..|
  Rat   238 LYTEVLGRPTTL--------------SETMAKADIWLIRTYWDLEFPHPVLPNFDFVGGLH-CRP 287

  Fly   275 PEPSDEELQKFLDKA-DHGVIYFSMGNDILIKFLPENIQELLLQTFATLNESIIWKSELLYMPDK 338
            .:|..:|::.|:..: :|||:.||:|:  ::..|.|....::....|.:.:.::|:.|.......
  Rat   288 AKPLPKEIEDFVQSSGEHGVVVFSLGS--MVGNLTEERANVIAAGLAQIPQKVLWRFEGKKPETL 350

  Fly   339 SDNVYVVEQAPQRHILNHPNVRLFITNGGLLSVIEAVDSGVPMLGLPMFFDQFGNMRWVQLSGMA 403
            ..|..:.:..||..:|.||..|.|||:||...:.||:..|:|::|:|:|.||:.|:..::..|.|
  Rat   351 GSNTRLYKWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPVVGIPLFGDQYDNIVHLKTKGAA 415

  Fly   404 EVMDINSLNKDTLTETIKHMLANNSYYLKAKEISQFFKDRPMSPLDTAVWWTEYALRNRNITRMR 468
            ..:|..:::...|...:|.:..:.||...|..:|:...|:|:.|||.||:|.|:.:|::....:|
  Rat   416 VRLDFLTMSSTDLFTALKTITNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLR 480

  Fly   469 LNLEEIPLIEYYRIDSILAFSLRFGLVAASLIFLVYTL 506
            :...::..::|:.:|.|       |.:.|.::.:::.|
  Rat   481 VAAHDLSWVQYHSLDVI-------GFLLACVVTVMFIL 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B1NP_651153.1 egt 21..462 CDD:223071 113/500 (23%)
UDPGT 41..511 CDD:278624 116/518 (22%)
Ugt2b10NP_001178605.1 UDPGT 26..529 CDD:278624 118/534 (22%)
egt 35..510 CDD:223071 116/521 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BDT1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.