DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT85A7

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_173652.1 Gene:UGT85A7 / 838841 AraportID:AT1G22340 Length:487 Species:Arabidopsis thaliana


Alignment Length:338 Identity:69/338 - (20%)
Similarity:128/338 - (37%) Gaps:97/338 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 SNSLLSKIYNWVHITEEKLLKHLIFRPSQLRIFKK---FFNFSEQKFYNMREKYSVILVN----- 252
            |...|..:.:|:...:...||.:   ||.:|....   ..||..:: ....::.|.|::|     
plant   178 SKEHLDTVIDWIPSMKNLRLKDI---PSYIRTTNPDNIMLNFLIRE-VERSKRASAIILNTFDEL 238

  Fly   253 NHISMGRVRSNVPNIIEVGGLHL------TEPAEPCDSKLQKFMDDAE----------HGVIYFS 301
            .|..:..::|.:|.:..:|.|||      .|.:|.....|..:.::.|          :.|::.:
plant   239 EHDVIQSMQSILPPVYSIGPLHLLVKEEINEASEIGQMGLNLWREEMECLDWLDTKTPNSVLFVN 303

  Fly   302 MGQEIMVQFLPEDMQQNLMKSLDQF-------KQRVVWKTELYNMPN--KSDNVYVIEQP----- 352
            .|...::.          .|.|::|       ::..:|...    ||  ..:.:.|:.|.     
plant   304 FGCITVMS----------AKQLEEFAWGLAASRKEFLWVIR----PNLVVGEAMVVLPQEFLAET 354

  Fly   353 ----------PQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLR------NV 401
                      ||..||:||....|:|:.|..|.:|::..|||::..|.|.:|..|.:      .|
plant   355 IDRRMLASWCPQEKVLSHPAIGGFLTHCGWNSTLESLAGGVPMICWPCFSEQPTNCKFCCDEWGV 419

  Fly   402 NLRGMAEVLDANEMTLEILTSTIRKLLENPRYALKAKKMSQSFRDRPMSPLDTAVWW---TEYAL 463
            .:    |:  ..::..|.:.:.:|:|::..    |.||:.:...:           |   .|.|.
plant   420 GI----EI--GKDVKREEVETVVRELMDGE----KGKKLREKAEE-----------WRRLAEEAT 463

  Fly   464 RNKDASH-MRLNT 475
            |.|..|. |.|.|
plant   464 RYKHGSSVMNLET 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 64/326 (20%)
UGT85A7NP_173652.1 Glycosyltransferase_GTB-type 12..481 CDD:385653 69/338 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.