DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT1G06000

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_563756.1 Gene:AT1G06000 / 837109 AraportID:AT1G06000 Length:435 Species:Arabidopsis thaliana


Alignment Length:466 Identity:90/466 - (19%)
Similarity:163/466 - (34%) Gaps:120/466 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SSHNLVVRPLAKALVKRGHNVT-LITPVGMPTDIEGVRHIRVPKLNQRVQEMIEGDQILDFFGSK 102
            |.|.:....|...::.||..|| |:||.. .:.::.:|.:..|:..:.:        ||.|....
plant    19 SGHMVPHLDLTHQILLRGATVTVLVTPKN-SSYLDALRSLHSPEHFKTL--------ILPFPSHP 74

  Fly   103 WIASLMVVSMLYNMSSDILSDKGVQKMLQNRNERFDLVMLEPSALEALYGVVEHYNATLMGFSGG 167
            .|.|                  ||:.:.|          |...|:..::..:...:..|:.|...
plant    75 CIPS------------------GVESLQQ----------LPLEAIVHMFDALSRLHDPLVDFLSR 111

  Fly   168 NVNWSTEEVAGNFAPSINDPISSLGYSRSNSLLSKIYNWVH-ITEEKLLKHLIFRPSQLRIF--- 228
            .             |..:.|.:.||    :|.||.   |:: :.:...:|.:.|.|......   
plant   112 Q-------------PPSDLPDAILG----SSFLSP---WINKVADAFSIKSISFLPINAHSISVM 156

  Fly   229 -----KKFFNFSE-----------QKFYNMREKYSVILVNNHISMGRVRSNVPNI-----IEVGG 272
                 :.|||..|           ..||::..::...:....::..|:.:..|.:     ::.||
plant   157 WAQEDRSFFNDLETATTESYGLVINSFYDLEPEFVETVKTRFLNHHRIWTVGPLLPFKAGVDRGG 221

  Fly   273 LHLTEPAEPCDSKLQKFMDDA--EHGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWKT- 334
            .....||     |:..::|..  ::.|:|...|.:|.   |..:....|..:|::...|.:|.. 
plant   222 QSSIPPA-----KVSAWLDSCPEDNSVVYVGFGSQIR---LTAEQTAALAAALEKSSVRFIWAVR 278

  Fly   335 ELYNMPNKSDNVYVIEQ---------------------PPQRAVLAHPNTRLFITNGGLLSVMEA 378
            :.....|.|||  .:|:                     .||..:|.|.....::|:.|..||:|.
plant   279 DAAKKVNSSDN--SVEEDVIPAGFEERVKEKGLVIRGWAPQTMILEHRAVGSYLTHLGWGSVLEG 341

  Fly   379 VYSGVPILGLPVFFDQFINLRNV--NLRGMAEVLDANEMTLEILTSTIRKLLENPRYALKAKKMS 441
            :..||.:|..|:..|.|.|...:  .||....| ..|..::.......|.|.|:.|..|..:...
plant   342 MVGGVMLLAWPMQADHFFNTTLIVDKLRAAVRV-GENRDSVPDSDKLARILAESAREDLPERVTL 405

  Fly   442 QSFRDRPMSPL 452
            ...|::.|..:
plant   406 MKLREKAMEAI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 90/466 (19%)
AT1G06000NP_563756.1 Glycosyltransferase_GTB-type 8..430 CDD:385653 90/466 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.