DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT5G38040

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_198620.1 Gene:AT5G38040 / 833784 AraportID:AT5G38040 Length:449 Species:Arabidopsis thaliana


Alignment Length:439 Identity:85/439 - (19%)
Similarity:161/439 - (36%) Gaps:87/439 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LAKALVKRGHNVTLITP----VGMPTDIEGVRHIRVPKLNQRVQEMIEGDQILDFFGSKWIASLM 108
            |||||..:|.::|::..    :....|:...:.:.:|       |.:....:.:....:::..| 
plant    28 LAKALHSKGFSITVVQTKFNYLNPSNDLSDFQFVTIP-------ENLPVSDLKNLGPGRFLIKL- 84

  Fly   109 VVSMLYNMSSDILSDKGVQKMLQNRNERFDLVMLEPSALEALYGVVEHYNATLMGFSGGNVNWST 173
             .:..|....|:|.     ::|.|..|....|:.:    |.:|.|    ...:..|...||..||
plant    85 -ANECYVSFKDLLG-----QLLVNEEEEIACVIYD----EFMYFV----EVAVKEFKLRNVILST 135

  Fly   174 EEVAGNFAPSI------NDPISSL--GYSRSNSLLSKIYNWVHITEEKLLKHLIFR--PSQLRIF 228
            ..........:      .|.::.|  |..|...|:.::|.    ...|.|...:|.  .|.:.:|
plant   136 TSATAFVCRFVMCELYAKDGLAQLKEGGEREVELVPELYP----IRYKDLPSSVFASVESSVELF 196

  Fly   229 KKFFNFSEQKFYNMREKYSVILVN-------NHISMGRVRSNVPNIIEVGGLHLTEPAEPC---- 282
            |...         .:...|.:::|       :.:...:....:| :..:|.||:...|.|.    
plant   197 KNTC---------YKGTASSVIINTVRCLEMSSLEWLQQELEIP-VYSIGPLHMVVSAPPTSLLE 251

  Fly   283 --DSKLQKFMDDAEHGVIYFSMGQEIMVQFLPE-DMQQNLMKSLDQFKQRVVW------------ 332
              :|.::.........|||.|:|...:::.... :|....:.|    .|..:|            
plant   252 ENESCIEWLNKQKPSSVIYISLGSFTLMETKEMLEMAYGFVSS----NQHFLWVIRPGSICGSEI 312

  Fly   333 -KTELYNMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFI 396
             :.||......:|..|:::..||:.||||.....|.::.|..|.:|::..|||::..|...||..
plant   313 SEEELLKKMVITDRGYIVKWAPQKQVLAHSAVGAFWSHCGWNSTLESLGEGVPLICRPFTTDQKG 377

  Fly   397 NLRNVNLRGMAEVLDANEMTLEILTSTIRKLL------ENPRYALKAKK 439
            |.|.:.......:....|:....:...:::|:      |..|.||..|:
plant   378 NARYLECVWKVGIQVEGELERGAIERAVKRLMVDEEGEEMKRRALSLKE 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 85/439 (19%)
AT5G38040NP_198620.1 Glycosyltransferase_GTB-type 1..446 CDD:415824 85/439 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.