DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT5G37950

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:395 Identity:82/395 - (20%)
Similarity:143/395 - (36%) Gaps:107/395 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LAKALVKRGHNVTL-------ITPVGMPTDIEGVRHIRVPKLNQRVQEMIEGDQILDFFGSKWIA 105
            |.:|...:|.::|:       :.|   ..|:...:.|.:|      :.:...|  |...|..|  
plant     4 LGRAHSLKGFSITVAQTKFNYLNP---SKDLADFQFITIP------ESLPASD--LKTLGPIW-- 55

  Fly   106 SLMVVSMLYNMSSDILSDKGVQKMLQNRNERFDLVMLEPSALEALYGVVEHYNATLMGFSGGNVN 170
              .::.:  |...:|...|.:.:.|..:.|....|:.:    |.:|    ...|....|:...|.
plant    56 --FIIKL--NKECEISFKKCLGQFLLQQQEEIACVIYD----EFMY----FAEAAAKEFNLPKVI 108

  Fly   171 WSTEEVAGNFAPS------INDPISSL--GYSRSNSLLSKIYNWVHITEEKLLKHLIFRP--SQL 225
            :|||........|      ..|.|:.|  |..|...|:.::    |....|.|....|.|  :.:
plant   109 FSTENATAFACRSAMCKLYAKDGIAPLTEGCGREEELVPEL----HPLRYKDLPTSAFAPVEASV 169

  Fly   226 RIFKKFFNFSEQKFYNMREKYSVILVNNHISMGRVRS--------NVPNIIEVGGLHLTEPAEP- 281
            .:||.          :..:..:..::.|.:|...:.|        .:| |..:|.|::...|.| 
plant   170 EVFKS----------SCEKGTASSMIINTVSCLEISSLEWLQQELKIP-IYPIGPLYMVSSAPPT 223

  Fly   282 --------CDSKLQKFMDDAEHGVIYFSMG-------QEIMVQFLPEDMQQNLMKSLDQFKQRVV 331
                    |...|.|   .....|||.|:|       :|::      :|...|:.|    .|..:
plant   224 SLLDENESCIDWLNK---QKPSSVIYISLGSFTLLETKEVL------EMASGLVSS----NQYFL 275

  Fly   332 W-------------KTELYNMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGV 383
            |             ..||::|....|..|:::...|:.||||.....|.::.|..|.:|::..|:
plant   276 WAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQVLAHAAVGAFWSHCGWNSTLESIGEGI 340

  Fly   384 PILGL 388
            ||:||
plant   341 PIVGL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 82/395 (21%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 79/391 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.