DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT78D2

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:245 Identity:66/245 - (26%)
Similarity:97/245 - (39%) Gaps:54/245 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 FYNMREKYSVILVNNHISMGRVRSNVPNIIEVGGLHLTEPAEPCDSKLQKFMDDAEHG------- 296
            |.|..|.....|.||      :||.....:.:|.|.|      ..|.||:.:.| .||       
plant   222 FINSFEDLDPTLTNN------LRSRFKRYLNIGPLGL------LSSTLQQLVQD-PHGCLAWMEK 273

  Fly   297 -----VIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVW---KTELYNMP-----NKSDNVYV 348
                 |.|.|.|   .|...|......:.:.|:..|...||   :..|..:|     ...:...|
plant   274 RSSGSVAYISFG---TVMTPPPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIV 335

  Fly   349 IEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLRNVNL---RGMAEV- 409
            :...||..:|.|..|.:|:|:.|..||:|:|..|||::..|.|.||.:|.|.|.:   .||..: 
plant   336 VPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIIN 400

  Fly   410 ----LDANEMTLE-ILTS--------TIRKLLENPRYALKAK-KMSQSFR 445
                .|..|..|: :|..        ..:||.|....|:.:| :.|::||
plant   401 GVFTKDGFEKCLDKVLVQDDGKKMKCNAKKLKELAYEAVSSKGRSSENFR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 66/245 (27%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 61/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.