DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT5G17040

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:314 Identity:65/314 - (20%)
Similarity:119/314 - (37%) Gaps:64/314 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 VNWSTEEVAGNFAPSINDPISSLGYSRSNSLLSKIYNWVHITEEKLLKHLIFRPSQLRIFKKFFN 233
            |:|.....:|..:..|:..|||...|.|...|..|.....|..:...:.::|.... .:|.|..:
plant   127 VSWVAFWTSGTRSLLISTQISSEKQSLSKETLGCISGMEKIRVKDTPEGVVFGNLD-SVFSKMLH 190

  Fly   234 -------FSEQKFYNMREKYSVILVNNHISMGRVRSNVPNIIEVGGLHLTEPAEPCDSKLQKFMD 291
                   .:...:.|..|:....|.:|      :|......:.:|.|.|.......::.|..   
plant   191 QMGLALPRATTVYMNSFEELDPTLTDN------LRLKFKRYLSIGPLALLFSTSQRETPLHD--- 246

  Fly   292 DAEHG------------VIYFSMGQ-------EIMVQFLPEDMQQNLMKSLDQFKQRVVWKTELY 337
              .||            |:|.:.|:       |::|          :.:.|:..|...||..:..
plant   247 --PHGCLAWIKKRSTASVVYIAFGRVMTPPPGELVV----------VAQGLESSKVPFVWSLQEK 299

  Fly   338 NM--------PNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQ 394
            ||        ....:...|:...||..:|.|....:|:::||..||:|:|.:|||::..|:|.|.
plant   300 NMVHLPKGFLDGTREQGMVVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDH 364

  Fly   395 FINLRNVNL---RGMAEVLDANEMTLEILTSTIRKLL---ENPRYALKAKKMSQ 442
            .:|.|:|..   .||  .:.:...|.:....::.::|   :..:....|||:.:
plant   365 ALNARSVEAVWEIGM--TISSGVFTKDGFEESLDRVLVQDDGKKMKFNAKKLKE 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 65/314 (21%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 65/314 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.