DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT78D3

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:235 Identity:49/235 - (20%)
Similarity:98/235 - (41%) Gaps:60/235 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 FKKFFNFSEQKFYNMREKYSVILVNNH----------------ISMGRVRSNVPNIIEVGGLHLT 276
            ||::.|.......:...:.|.::.:.|                |:.|||.:..|       :.|.
plant   238 FKRYLNIGPLALLSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFGRVATPPP-------VELV 295

  Fly   277 EPAEPCDSKLQKFMDDAEHGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWKTELYNMPN 341
            ..|:..:|....|:         :|: ||:.:..|||..       ||:.:::.:          
plant   296 AIAQGLESSKVPFV---------WSL-QEMKMTHLPEGF-------LDRTREQGM---------- 333

  Fly   342 KSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLRNVN-LRG 405
                  |:...||..:|.|....:|:::||..||:|:|.:|||::..|:|.|..||.|:|. :..
plant   334 ------VVPWAPQVELLNHEAMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWE 392

  Fly   406 MAEVLDANEMTLEILTSTIRKLL---ENPRYALKAKKMSQ 442
            :...:.:...|.:....::.::|   :..:..:.|||:.:
plant   393 IGVTISSGVFTKDGFEESLDRVLVQDDGKKMKVNAKKLEE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 49/235 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 49/235 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.