DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT76C1

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_196206.1 Gene:UGT76C1 / 830472 AraportID:AT5G05870 Length:464 Species:Arabidopsis thaliana


Alignment Length:233 Identity:59/233 - (25%)
Similarity:95/233 - (40%) Gaps:67/233 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 HITEEKLLKHLIFRPSQLRIFKKFFNFSEQKFYNMREKYSVILVNNHISMGRVRS-NVPNIIEVG 271
            ||.:.......:..|.|..|          .:.:|||..||:    ::|:|.:.| |..:.:|:.
plant   242 HIHDVPASSSSLLEPDQSCI----------PWLDMRETRSVV----YVSLGSIASLNESDFLEIA 292

  Fly   272 -GLHLTEPAEPCDSKLQKFMDDAEHGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWKTE 335
             ||..|.         |.|:.....|.::   |::.:     |.:....|:|||...:.|.|   
plant   293 CGLRNTN---------QSFLWVVRPGSVH---GRDWI-----ESLPSGFMESLDGKGKIVRW--- 337

  Fly   336 LYNMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLR- 399
                            .||..||||..|..|:|:.|..|.:|::..|||::.||..:|||:|.| 
plant   338 ----------------APQLDVLAHRATGGFLTHNGWNSTLESICEGVPMICLPCKWDQFVNARF 386

  Fly   400 -------NVNLRGMAEVLDANEMTLEILTSTIRKLLEN 430
                   .::|.|..|       ..||..:.||.::|:
plant   387 ISEVWRVGIHLEGRIE-------RREIERAVIRLMVES 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 59/233 (25%)
UGT76C1NP_196206.1 Glycosyltransferase_GTB_type 2..451 CDD:299143 59/233 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.