DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT76C2

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:230 Identity:54/230 - (23%)
Similarity:85/230 - (36%) Gaps:79/230 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 EKYSVILVNNHISMGRVRSNVPNIIEVGGLHLTEPAEPC-----DSKLQKFMDDAE-HGVIYFSM 302
            ||.|:.|.|...       .|| :..:|..|....|...     |.....::||.| ..|||.|:
plant   214 EKDSLTLSNEIF-------KVP-VFAIGPFHSYFSASSSSLFTQDETCILWLDDQEDKSVIYVSL 270

  Fly   303 GQEIMV---QFLP---------------------------EDMQQNLMKSLDQFKQRVVWKTELY 337
            |..:.:   :||.                           |.:.:.|:.||::..:.|.|     
plant   271 GSVVNITETEFLEIACGLSNSKQPFLWVVRPGSVLGAKWIEPLSEGLVSSLEEKGKIVKW----- 330

  Fly   338 NMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLR--- 399
                          .||:.||||..|..|:|:.|..|.:|::..|||::.||..:||.:|.|   
plant   331 --------------APQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNSRFVS 381

  Fly   400 -----NVNLRGMAEVLDANEMTLEILTSTIRKLLE 429
                 .::|.|..|..:        :...:|.|:|
plant   382 DIWKIGIHLEGRIEKKE--------IEKAVRVLME 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 54/230 (23%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 54/230 (23%)
YjiC 9..429 CDD:224732 54/230 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.