DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT4G27570

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_194487.1 Gene:AT4G27570 / 828866 AraportID:AT4G27570 Length:453 Species:Arabidopsis thaliana


Alignment Length:486 Identity:96/486 - (19%)
Similarity:167/486 - (34%) Gaps:163/486 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LAKALVKRGHNVTLITPV---------------------------GMPTDIEGVRHIRVPKLN-- 83
            ||..|.::||.||.:.|.                           |:|...|....|.|...:  
plant    25 LANKLAEKGHTVTFLLPKKSLKQLEHFNLFPHNIVFRSVTVPHVDGLPVGTETASEIPVTSTDLL 89

  Fly    84 -----------QRVQEMIEGDQI-LDFFGSKWIA------SLMVVSMLYNMSSDILS------DK 124
                       :.|...:|.|.| .||  :.||.      .|..|..:...:|.|.|      :.
plant    90 MSAMDLTRDQVEAVVRAVEPDLIFFDF--AHWIPEVARDFGLKTVKYVVVSASTIASMLVPGGEL 152

  Fly   125 GV-------QKMLQNRNERFDLVMLEP-SALEALYGVVEHYNATLMGFSGGNVNWSTEEVAGNFA 181
            ||       .|:|..:.:.:.:..||| :.::....::|....:||......:. :..|:.|||.
plant   153 GVPPPGYPSSKVLLRKQDAYTMKKLEPTNTIDVGPNLLERVTTSLMNSDVIAIR-TAREIEGNFC 216

  Fly   182 PSINDPISSLGYSRSNSLLSKIYNWVHITEEKLLKHLIF-RPSQLRIFKKFFNFSEQKFYNMREK 245
            ..|..                     |..::.||...:| .|.:.|..::.:    .|:.:..|.
plant   217 DYIEK---------------------HCRKKVLLTGPVFPEPDKTRELEERW----VKWLSGYEP 256

  Fly   246 YSVILVNNHISMGRVRSNVPNIIEVG-------GLHLTEPAEPCDSKLQKFMDDAEHGVIYFSMG 303
            .||:.    .::|   |.|  |:|..       |:.||                          |
plant   257 DSVVF----CALG---SQV--ILEKDQFQELCLGMELT--------------------------G 286

  Fly   304 QEIMVQFLPEDMQQNLMKSLDQ-FKQRV-----VWKTELYNMPNKSDNVYVIEQPPQRAVLAHPN 362
            ...:|...|......:.::|.: |::||     ||..             .::||   .:|:||:
plant   287 SPFLVAVKPPRGSSTIQEALPEGFEERVKGRGLVWGG-------------WVQQP---LILSHPS 335

  Fly   363 TRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLRNVN--LRGMAEVLDANEMT----LEILT 421
            ...|:::.|..|:.|::.|...|:.:|...||.:|.|.::  |:...||  |.|.|    .|.|.
plant   336 VGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNTRLLSDELKVSVEV--AREETGWFSKESLC 398

  Fly   422 STIRKLLE-NPRYALKAKKMSQSFRDRPMSP 451
            ..:..::: :.......:|....:|:...||
plant   399 DAVNSVMKRDSELGNLVRKNHTKWRETVASP 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 96/486 (20%)
AT4G27570NP_194487.1 PLN02764 1..452 CDD:178364 96/486 (20%)
MGT 15..414 CDD:273616 92/469 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.