DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT3G55710

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_191130.1 Gene:AT3G55710 / 824737 AraportID:AT3G55710 Length:464 Species:Arabidopsis thaliana


Alignment Length:229 Identity:53/229 - (23%)
Similarity:89/229 - (38%) Gaps:38/229 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 RVRSNVPNIIEVGGLHLTEPAEPCDSKLQKFMDD----------AEHGVIYFSMGQEIMVQ---- 309
            |.:..|| :..:|..|......|...|.:...||          |...|:|.|.|....::    
plant   225 RSKLQVP-LFPIGPFHKHRTDLPPKPKNKDKDDDEILTDWLNKQAPQSVVYVSFGSLAAIEENEF 288

  Fly   310 -FLPEDMQQNLMKSLDQFKQRVVWKTE-LYNMP-----NKSDNVYVIEQPPQRAVLAHPNTRLFI 367
             .:...::.:.:..|...:..:|..|| |.::|     |......:::...|...||||....|.
plant   289 FEIAWGLRNSELPFLWVVRPGMVRGTEWLESLPCGFLENIGHQGKIVKWVNQLETLAHPAVGAFW 353

  Fly   368 TNGGLLSVMEAVYSGVPILGLPVFFDQFINLRN-VNLRGMAEVLDANEM-TLEI----------- 419
            |:.|..|.:|::..|||::..|.|.||.:|.|. |::..:..:|:..:| ..||           
plant   354 THCGWNSTIESICEGVPMICTPCFSDQHVNARYIVDVWRVGMMLERCKMERTEIEKVVTSVMMEN 418

  Fly   420 ---LTSTIRKLLENPRYALKAKKMSQSFRDRPMS 450
               ||....:|.|.....|.....|..:.|:.:|
plant   419 GAGLTEMCLELKEKANVCLSEDGSSSKYLDKLVS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 53/229 (23%)
AT3G55710NP_191130.1 Glycosyltransferase_GTB_type 1..454 CDD:299143 53/229 (23%)
YjiC 7..421 CDD:224732 45/196 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.