DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT3G46690

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:369 Identity:80/369 - (21%)
Similarity:130/369 - (35%) Gaps:126/369 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FDLVMLE---PSALEALYGVVEHYNATLMGFSGGNVNWSTEEVAGNFAPSINDPISSLGYSRSNS 198
            ||.|.:.   |.:.....|..|:    ||     |:|.::|       .|..:.||.|...:.|.
plant    58 FDFVTIPESLPQSESKKLGPAEY----LM-----NLNKTSE-------ASFKECISQLSMQQGND 106

  Fly   199 LLSKIYNWV-----HITEEKLLKHLIFRPSQLRI---FKKFFNFSEQKF-YNMR--EKYSVILVN 252
            :...||:.:     ...:|..:..:||..|...|   :......|.:|| .:|:  ||...:|..
plant   107 IACIIYDKLMYFCEAAAKEFKIPSVIFSTSSATIQVCYCVLSELSAEKFLIDMKDPEKQDKVLEG 171

  Fly   253 NH------------------ISMGR----------VRSNVPNIIE-----------------VGG 272
            .|                  :.|.|          |..|..:.:|                 :|.
plant   172 LHPLRYKDLPTSGFGPLEPLLEMCREVVNKRTASAVIINTASCLESLSLSWLQQELGIPVYPLGP 236

  Fly   273 LHLTEPAEPCDSKLQKFMDDAE-------HGVIYFSMG-------QEIMVQFLPEDMQQNLMKSL 323
            ||:| .:.|..|.||:.|...|       ..|||.|:|       :|::      :|...|:.| 
plant   237 LHIT-ASSPGPSLLQEDMSCIEWLNKQKPRSVIYISLGTKAHMETKEML------EMAWGLLNS- 293

  Fly   324 DQFKQRVVWK-----------TELYNMPNK-----SDNVYVIEQPPQRAVLAHPNTRLFITNGGL 372
               .|..:|.           .||  :|.:     ::..|:.:..||..||.||....|.::.|.
plant   294 ---NQPFLWVIRPGSVAGFEWIEL--LPEEVIKMVTERGYIAKWAPQIEVLGHPAVGGFWSHCGW 353

  Fly   373 LSVMEAVYSGVPILGLPVFFDQFINLR--------NVNLRGMAE 408
            .|.:|::..|||::..|:..:|.:|..        .:.|.|..|
plant   354 NSTLESIVEGVPMICRPLQGEQKLNAMYIESVWKIGIQLEGEVE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 80/369 (22%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 80/369 (22%)
YjiC 7..431 CDD:224732 80/369 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.