DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT71B1

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_188812.1 Gene:UGT71B1 / 821729 AraportID:AT3G21750 Length:473 Species:Arabidopsis thaliana


Alignment Length:473 Identity:94/473 - (19%)
Similarity:164/473 - (34%) Gaps:131/473 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GVRHIRVPKLNQRVQEMIEGDQILDFFGSKWIASLMVV---------SMLYNMSSDILSDKGVQK 128
            ||.|||......::  ::..|..|.       .:|:|:         |.:|..|.|.|.    ..
plant    12 GVGHIRATTALAKL--LVASDNRLS-------VTLIVIPSRVSDDASSSVYTNSEDRLR----YI 63

  Fly   129 MLQNRNERFDLVMLEPSALEALYGVVEHYNATLMGFSGGNVNWSTEE-----VAGNFAPSINDPI 188
            :|..|::..|||....|....:..||...        .|:|:..::.     |...|..|:.|..
plant    64 LLPARDQTTDLVSYIDSQKPQVRAVVSKV--------AGDVSTRSDSRLAGIVVDMFCTSMIDIA 120

  Fly   189 SSLG------YSRSNSLLSKIYNWVHITEEKLLKHLIFRPSQLR-------------------IF 228
            ....      |:.:.|.|...::...:.:||.|....|:.::::                   :.
plant   121 DEFNLSAYIFYTSNASYLGLQFHVQSLYDEKELDVSEFKDTEMKFDVPTLTQPFPAKCLPSVMLN 185

  Fly   229 KKFFNFSEQKFYNMREKYSVILVNNHISM----------GRVRSNVPNIIEVG---GLHLTEPAE 280
            ||:|.:...:..:.|.... ||||:...|          |...:|:|.:..||   .|..:...|
plant   186 KKWFPYVLGRARSFRATKG-ILVNSVADMEPQALSFFSGGNGNTNIPPVYAVGPIMDLESSGDEE 249

  Fly   281 PCDSKLQKFMDDAEHGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWKTELYN-MPNKSD 344
            .....|....:.....|::...|.  |..| .|:..:.:..:|::...|.:|.....: :.|||:
plant   250 KRKEILHWLKEQPTKSVVFLCFGS--MGGF-SEEQAREIAVALERSGHRFLWSLRRASPVGNKSN 311

  Fly   345 -------NV----------------YVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPIL 386
                   |:                .:|...||..||..|....|:|:.|..|::|:::.|||:.
plant   312 PPPGEFTNLEEILPKGFLDRTVEIGKIISWAPQVDVLNSPAIGAFVTHCGWNSILESLWFGVPMA 376

  Fly   387 GLPVFFDQFINLRNVNLRGMAEVLDANEMTLEI-LTSTIRK------LLENPRYALK-------- 436
            ..|::.:|..|              |..|..|: |.:.::|      |:|.|.....        
plant   377 AWPIYAEQQFN--------------AFHMVDELGLAAEVKKEYRRDFLVEEPEIVTADEIERGIK 427

  Fly   437 -AKKMSQSFRDRPMSPLD 453
             |.:.....|.|.|...|
plant   428 CAMEQDSKMRKRVMEMKD 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 94/473 (20%)
UGT71B1NP_188812.1 Glycosyltransferase_GTB_type 1..473 CDD:299143 94/473 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.