DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT88A1

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_566550.1 Gene:UGT88A1 / 820900 AraportID:AT3G16520 Length:462 Species:Arabidopsis thaliana


Alignment Length:294 Identity:66/294 - (22%)
Similarity:111/294 - (37%) Gaps:65/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 IFKKFFNFSEQKFYNMREKYSVILVNNHISM-GRVRSNVP------NIIEVGGLHLTEPAEP-CD 283
            ::..|..|.:|     ..|.|.|::|...:: .|....:.      ||..:|.|.:....|. .|
plant   195 VYDVFIMFGKQ-----LSKSSGIIINTFDALENRAIKAITEELCFRNIYPIGPLIVNGRIEDRND 254

  Fly   284 SK----LQKFMDDAEHGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVW---------KTE 335
            :|    |.......|..|::...|.   :....::....:...|::..||.:|         |||
plant   255 NKAVSCLNWLDSQPEKSVVFLCFGS---LGLFSKEQVIEIAVGLEKSGQRFLWVVRNPPELEKTE 316

  Fly   336 L---------YNMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVF 391
            |         :....:...:.|....||..||.|.....|:|:.|..|::|||.:|||::..|::
plant   317 LDLKSLLPEGFLSRTEDKGMVVKSWAPQVPVLNHKAVGGFVTHCGWNSILEAVCAGVPMVAWPLY 381

  Fly   392 FDQFINLRNVNLRGMAEVLDANEMTLEILTSTIRKLLENPRYALKAKKMSQSF------RDRPMS 450
            .:|..| |.:.:..:...:..||.....::||            :.:|..|..      |:|.|:
plant   382 AEQRFN-RVMIVDEIKIAISMNESETGFVSST------------EVEKRVQEIIGECPVRERTMA 433

  Fly   451 PLDTAVWWTEYALRNKDASHMRLNTEDVPLYYEW 484
            ..:.|    |.||....:||..|.|    |...|
plant   434 MKNAA----ELALTETGSSHTALTT----LLQSW 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 60/274 (22%)
UGT88A1NP_566550.1 PLN03004 1..451 CDD:178581 62/280 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.