DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and UGT73C2

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_181214.1 Gene:UGT73C2 / 818248 AraportID:AT2G36760 Length:496 Species:Arabidopsis thaliana


Alignment Length:458 Identity:104/458 - (22%)
Similarity:169/458 - (36%) Gaps:140/458 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IFSYHFSSHNLVVRPLAKALVKRGHNVTLITPVGMPTD-----------IEGVRHIRVPKLNQRV 86
            :|.:....|.:.:..:|:.|.:||..:|::|   .|.:           |:...||||..:....
plant    17 LFPFMAQGHMIPMVDIARILAQRGVTITIVT---TPHNAARFKDVLNRAIQSGLHIRVEHVKFPF 78

  Fly    87 QE--MIEGDQILDFFGSKWIASLMV-----VSMLYNMSSDILSDKGVQKMLQNRNERFDLVMLEP 144
            ||  :.||.:.:||..|   ..|||     |:||.|         .|.|:::....:       |
plant    79 QEAGLQEGQENVDFLDS---MELMVHFFKAVNMLEN---------PVMKLMEEMKPK-------P 124

  Fly   145 SALEALY------GVVEHYNATLMGFSGGNVNWSTEEVAGNFAPSINDPISSLGYSRSNSLLSKI 203
            |.|.:.:      .:.:.:|...:.|.|                      .|.....|..:|.:.
plant   125 SCLISDFCLPYTSKIAKRFNIPKIVFHG----------------------VSCFCLLSMHILHRN 167

  Fly   204 YNWVHITEEKLLKHLIFRPS--------QLRIFKKFFNFSEQKFYNMREK-------YSVIL--- 250
            :|.:|..:..  |.....||        :|::..| .|||......|.|:       |.||:   
plant   168 HNILHALKSD--KEYFLVPSFPDRVEFTKLQVTVK-TNFSGDWKEIMDEQVDADDTSYGVIVNTF 229

  Fly   251 -------VNNHIS--MGRVRSNVPNII--EVG------GLHLTEPAEPC----DSKLQKFMDDAE 294
                   |.|:..  .|:|.|..|..:  :||      |.......:.|    |||      |.|
plant   230 QDLESAYVKNYTEARAGKVWSIGPVSLCNKVGEDKAERGNKAAIDQDECIKWLDSK------DVE 288

  Fly   295 HGVIYFSMGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWKT-------EL--------YNMPNKSD 344
             .|:|..:|.   :..||....:.|...|:..|:..:|..       ||        :....|..
plant   289 -SVLYVCLGS---ICNLPLAQLRELGLGLEATKRPFIWVIRGGGKYHELAEWILESGFEERTKER 349

  Fly   345 NVYVIEQPPQRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQFINLRNVNLRGMAEV 409
            ::.:....||..:|:||....|:|:.|..|.:|.:.||||::..|:|.|||.|.:.:     .:|
plant   350 SLLIKGWSPQMLILSHPAVGGFLTHCGWNSTLEGITSGVPLITWPLFGDQFCNQKLI-----VQV 409

  Fly   410 LDA 412
            |.|
plant   410 LKA 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 104/458 (23%)
UGT73C2NP_181214.1 Glycosyltransferase_GTB_type 13..495 CDD:299143 104/458 (23%)
YjiC 14..463 CDD:224732 104/458 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.