DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT2G30150

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001323694.1 Gene:AT2G30150 / 817567 AraportID:AT2G30150 Length:456 Species:Arabidopsis thaliana


Alignment Length:448 Identity:93/448 - (20%)
Similarity:158/448 - (35%) Gaps:137/448 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LAKALVKRGHNVT---LITP-----VGMPTDIEGVRHIRVPKL--------NQ----------RV 86
            |.|:||:|..|:|   ::|.     :|.......:....:|.:        |.          |:
plant    31 LCKSLVRRDPNLTVTFVVTEEWLGFIGSDPKPNRIHFATLPNIIPSELVRANDFIAFIDAVLTRL 95

  Fly    87 QEMIEGDQILDFFGSK---------------------------WIASLMVVSMLYNMSSDILSDK 124
            :|..|  |:||...|.                           |..|..::|:..|  ||:|:..
plant    96 EEPFE--QLLDRLNSPPTAIIADTYIIWAVRVGTKRNIPVASFWTTSATILSLFIN--SDLLASH 156

  Fly   125 G---VQKMLQNRNERFDLVM-LEPSALEALYGVVEHYNATLMGFSGGNVNWSTEEVAGNFAPSIN 185
            |   ::......:|..|.:. |.|:.|..|        ..|.|:|        .:|...|..|..
plant   157 GHFPIEPSESKLDEIVDYIPGLSPTRLSDL--------QILHGYS--------HQVFNIFKKSFG 205

  Fly   186 DPISSLGYSRSNSLLSKIYNWVHITEEKLLKHLIFRPSQLRIFKKFFNFSEQKFYNMREKYSVIL 250
            :                :|.         .|:|:| ||...:..|..:|...||.........::
plant   206 E----------------LYK---------AKYLLF-PSAYELEPKAIDFFTSKFDFPVYSTGPLI 244

  Fly   251 VNNHISMGRVRSNVPNIIEVGGLHLTEPAEPCDSKLQKFMDD-AEHGVIYFSMGQEIMVQFLPED 314
            ....:|:|.                    |..:....|::|: .|..|:|.|.|..:.|.   |.
plant   245 PLEELSVGN--------------------ENRELDYFKWLDEQPESSVLYISQGSFLSVS---EA 286

  Fly   315 MQQNLMKSLDQFKQRVVW-----KTELYNMPNKSDNVYVIEQPPQRAVLAHPNTRLFITNGGLLS 374
            ..:.::..:.:...:..|     :.:|......|..| |:....|..||.|.....|.|:.|..|
plant   287 QMEEIVVGVREAGVKFFWVARGGELKLKEALEGSLGV-VVSWCDQLRVLCHAAIGGFWTHCGYNS 350

  Fly   375 VMEAVYSGVPILGLPVFFDQFINLRNVNLR---GMAEVLDANEMTLEILTSTIRKLLE 429
            .:|.:.||||:|..|||:|||:|.:.:...   ||. :....:|.|.|::..|::|::
plant   351 TLEGICSGVPLLTFPVFWDQFLNAKMIVEEWRVGMG-IERKKQMELLIVSDEIKELVK 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 93/448 (21%)
AT2G30150NP_001323694.1 PLN02448 11..456 CDD:215247 93/448 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.