DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT2G29710

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_180532.1 Gene:AT2G29710 / 817521 AraportID:AT2G29710 Length:467 Species:Arabidopsis thaliana


Alignment Length:272 Identity:62/272 - (22%)
Similarity:113/272 - (41%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 YSRSNSLLSKIYNWVHITEEKLLKHLIFRPSQLRIFKKFFNFSEQKFYNMREKYSVILVN----- 252
            ::|::..:..|..:|:....|:|      ||.|.|...:  .::.|...:..|.:.||||     
plant   166 FARNSEEMLSIPGFVNPVPAKVL------PSALFIEDGY--DADVKLAILFTKANGILVNTSFDI 222

  Fly   253 -----NHISMGRVRSNVPNIIEVGGL-------HLTEPAEPCDSKLQKFMD-DAEHGVIYF---S 301
                 ||. :|  ..|.|::..||.:       |..:....||..: |::| ..|..|::.   |
plant   223 EPTSLNHF-LG--EENYPSVYAVGPIFNPKAHPHPDQDLACCDESM-KWLDAQPEASVVFLCFGS 283

  Fly   302 MGQEIMVQFLPEDMQQNLMKSLDQFKQRVVWK---TELYN--------MPNKSDNVYVIEQPPQR 355
            ||.      |...:.:.:...|:..:.|.:|.   .|:.|        |...|....:....||.
plant   284 MGS------LRGPLVKEIAHGLELCQYRFLWSLRTEEVTNDDLLPEGFMDRVSGRGMICGWSPQV 342

  Fly   356 AVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQ----FINLRNVNLR---------GMA 407
            .:|||.....|:::.|..|::|:::.||||:..|::.:|    |:.::.:.|.         ...
plant   343 EILAHKAVGGFVSHCGWNSIVESLWFGVPIVTWPMYAEQQLNAFLMVKELKLAVELKLDYSVHSG 407

  Fly   408 EVLDANEMTLEI 419
            |::.|||:...|
plant   408 EIVSANEIETAI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 62/272 (23%)
AT2G29710NP_180532.1 PLN02207 1..467 CDD:177857 62/272 (23%)
YjiC 7..466 CDD:224732 62/272 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.