DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and AT2G22930

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_179877.1 Gene:AT2G22930 / 816824 AraportID:AT2G22930 Length:442 Species:Arabidopsis thaliana


Alignment Length:486 Identity:87/486 - (17%)
Similarity:158/486 - (32%) Gaps:183/486 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IFSYHFSSHNLVVRPLAKALVKRGHNVTLITPV---------------------------GMPTD 70
            :|.:....|.:....||..|.::||.:|.:.|.                           |:|..
plant     9 MFPWFAFGHMIPFLHLANKLAEKGHQITFLLPKKAQKQLEHHNLFPDSIVFHPLTIPHVNGLPAG 73

  Fly    71 IEGVRHIRVPKLNQRVQEMIE--GDQI----------LDFFG-SKWIASLMVVSMLYNMSSDILS 122
            .|....|.: .::..:.|.::  .||:          |.||. :.||..:....|:.::|..|:|
plant    74 AETTSDISI-SMDNLLSEALDLTRDQVEAAVRALRPDLIFFDFAHWIPEIAKEHMIKSVSYMIVS 137

  Fly   123 DKGVQKMLQNRNERFDLVMLEPSALEALYGVVEHYNATLMGFS---GGNVNWSTEEVAGNFAPSI 184
                                                ||.:.::   ||        |.|  .|..
plant   138 ------------------------------------ATTIAYTFAPGG--------VLG--VPPP 156

  Fly   185 NDPISSLGYSRSN----SLLSKIYNWVHITEEKLLKHLI---FRPSQLRIFKKFFNFSEQKF--Y 240
            ..|.|.:.|..::    :.||..|        |.|.|.|   |:...: |..:..|..|.||  |
plant   157 GYPSSKVLYRENDAHALATLSIFY--------KRLYHQITTGFKSCDI-IALRTCNEIEGKFCDY 212

  Fly   241 NMREKYSVILVNNHISMGRVRSNVPNIIEVGGLHLTEPAEPCDSKLQKFMDD-AEHGVIYFSMGQ 304
            ...:.:..:|:..           |.:.|      .:.::|.:.:|..|:.. ....|::.::|.
plant   213 ISSQYHKKVLLTG-----------PMLPE------QDTSKPLEEQLSHFLSRFPPRSVVFCALGS 260

  Fly   305 EIMVQFLPEDMQQNLMKSLDQFKQRVVWKTELYNMPNKSDNVYVIEQPP---------------- 353
            :|:::             .||| |.:....||..:|     ..:..:||                
plant   261 QIVLE-------------KDQF-QELCLGMELTGLP-----FLIAVKPPRGSSTVEEGLPEGFQE 306

  Fly   354 --------------QRAVLAHPNTRLFITNGGLLSVMEAVYSGVPILGLPVFFDQ--FINLRNVN 402
                          |..:|.||:...|:.:.|..::.|.:.:...::.||...||  |..|....
plant   307 RVKGRGVVWGGWVQQPLILDHPSIGCFVNHCGPGTIWECLMTDCQMVLLPFLGDQVLFTRLMTEE 371

  Fly   403 LRGMAEVLDANEMT----LEILTSTIRKLLE 429
            .:...||  :.|.|    .|.|:..|:.:::
plant   372 FKVSVEV--SREKTGWFSKESLSDAIKSVMD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 87/486 (18%)
AT2G22930NP_179877.1 Glycosyltransferase_GTB_type 1..442 CDD:299143 87/486 (18%)
MGT 8..403 CDD:273616 87/486 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.