DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:129 Identity:29/129 - (22%)
Similarity:56/129 - (43%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 ILSDKGVQKMLQNRNERFDLVMLEP--SALEALYGVVEHYNATLMGFSGGNVNWSTEEVAGNFAP 182
            :|.||.:.:.|  |.|.|||.:.||  :...||:..:: ..|.:...|...::..::.:....||
 Worm    26 VLEDKELIERL--RAENFDLAITEPFDTCANALFEAIK-IRAHVAVLSCSRLDHVSKAIGQPIAP 87

  Fly   183 SINDPISSLGYSRSNSLLSKIYNWVH----------ITEE--KLLKHLI-----FRPSQLRIFK 229
            |.. |.:...:....::..:..|.:|          |.:|  |:.|.:|     :|.|.|.:::
 Worm    88 SYL-PGTQSTHGERMTIWQRFMNILHFLMGDFLFSYIGDEDFKVAKEIIPGVRSWRVSGLELYR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 egt 7..466 CDD:223071 29/129 (22%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 21/97 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.