DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B3 and ugt-62

DIOPT Version :10

Sequence 1:NP_651152.1 Gene:Ugt303B3 / 42774 FlyBaseID:FBgn0039085 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_497918.1 Gene:ugt-62 / 175591 WormBaseID:WBGene00010904 Length:531 Species:Caenorhabditis elegans


Alignment Length:151 Identity:29/151 - (19%)
Similarity:57/151 - (37%) Gaps:47/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VHQRTRHEYVLKLACLKGAGSFHMQVDEREPLSVR---------YRVQEALVQEPQYAS---TKV 121
            :.:|:.|     :|....||||..::|::...|.:         .|.....:||.:.:|   ::.
 Worm   685 IPERSSH-----VAAECSAGSFSEEIDDKPSTSNQSDPDFGYRPVRFMRTALQESRISSAILSEE 744

  Fly   122 ESTSGTLIMVACGEAPDVKAAVQVAPFKVDFFQQGRLVVTANGKGMMRFEHLRRKPEPKTEQQLQ 186
            |.....|::.....||:              |:|....::...:.:...|        :|::|::
 Worm   745 ELLDALLLLYHIAVAPN--------------FKQASYYMSHQSQSISLLE--------ETDKQIR 787

  Fly   187 EEAAAD--------RGEQKED 199
            |.|:.|        |...|||
 Worm   788 ERASCDQIKRLKEARNNYKED 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B3NP_651152.1 GT1_Gtf-like 28..458 CDD:340817 29/151 (19%)
ugt-62NP_497918.1 Glycosyltransferase_GTB-type 37..520 CDD:471961
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.