DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10175 and ces2b

DIOPT Version :9

Sequence 1:NP_001287487.1 Gene:CG10175 / 42773 FlyBaseID:FBgn0039084 Length:707 Species:Drosophila melanogaster
Sequence 2:XP_021326380.1 Gene:ces2b / 561967 ZFINID:ZDB-GENE-041014-96 Length:1611 Species:Danio rerio


Alignment Length:604 Identity:185/604 - (30%)
Similarity:276/604 - (45%) Gaps:124/604 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TMSPENATKSENASGSLDMRQMAHMGSSTTETTAWKTLTSHPNSLVQLLPSRAMRVVQEVVRSLR 149
            |..||...::|..|..||.:       ::|:...     .|...:.|..|    |::.|     |
Zfish   508 TSWPEFGDEAEYLSIGLDPK-------ASTDLKG-----KHFTFVTQTFP----RILSE-----R 551

  Fly   150 KEREIVATTSLGKVRGRYQKYRSGERGGYYSFKGMRYGAPPTGARRFRAAEPEKPWSGIRDASRE 214
            ||..:| .|.||.:||.|...: |:.....|:..:.:...|.|..|....:|...|.|:|||:::
Zfish   552 KEGPVV-NTKLGSLRGSYMMAK-GKDSVISSYFAIPFAKSPVGPLRLTPPQPADAWQGVRDATKQ 614

  Fly   215 GQSC-PHKNMILDTF----------KGDEDCLFVNVFTTQMPKDDESAEQPKLPVMVWLHGGGFS 268
            ...| ..|.:::|..          :..||||::|::|...|.|::     |||||||:||||.:
Zfish   615 PPMCLQPKEVMVDLLATMPLKTEFPEVSEDCLYLNIYTPSKPGDNK-----KLPVMVWIHGGGLA 674

  Fly   269 FGSGNSFLYGPDYLVA-EDIVLVTLNYRLGPLGFLTAGPD-APGNQGLKDQVLALKWVRDNIAAF 331
            |||.:  ::....|.| :|||:|.:.||||.|||.:.|.: ||||.||.|||.||:||::||.:|
Zfish   675 FGSAS--IFDAHALAAYQDIVVVMVQYRLGLLGFFSTGDEHAPGNYGLLDQVAALQWVQENIHSF 737

  Fly   332 GGDPNQVTIFGESAGASSVQLLLLSSQAKGLFHRAISQSGSALNPWSMSASSSQRAARLAANLGY 396
            ||||..||:||||||..|..||:||..:..||||||::||:|    :|:|..|......|.:||.
Zfish   738 GGDPGSVTVFGESAGGVSASLLVLSPLSANLFHRAIAESGTA----AMNAIMSPDPLSTARSLGN 798

  Fly   397 VGA---NKTEDILDFLRRVPAMKLVEAAPTTITAEDQRNNIGLPFVPVVEGYWNQDSQEEQFYEE 458
            |..   :.|:.|:|.:.::....:::.|         |..:.|.|...|:|              
Zfish   799 VSGCDISSTKKIVDCVMQMTEEDILKIA---------REQVLLRFGVTVDG-------------- 840

  Fly   459 PFLTQHPSDMYHSQNFNSDVAYMTGYNTHEAMLFIRRLRKNPQLLSIIENDFGRLVPQDLNVTES 523
            .||.:...::..||.| |.|..|||                     :.::|.|..:|:.:.....
Zfish   841 QFLPKSVDELLQSQEF-SKVPLMTG---------------------VTDDDGGFTLPEFIAPPGW 883

  Fly   524 HDRVTR-EIRSF--------------------YLGSKHVGIESVDEMIALLTDLMFLQGIRRTAR 567
            .|.:|: :|..|                    |||:....|:..|....::.|..|....|:.|.
Zfish   884 RDGMTKDQIMPFLPTYNYDLQDPGLAEIVLKEYLGATTDKIKIRDGFREIVGDFFFNLPARKLAN 948

  Fly   568 NHAKFGNAPVYMYRFSFDGSLGLYKRMLGIPRPGVCHGDEL----GYLFKFGFFNLSLDPKSMEV 628
            .|...| ||||||.|.....:...||...:   |..|||||    ||.|..|...:..:....|.
Zfish   949 YHRDTG-APVYMYEFQHPAYIFQNKRPSFV---GCDHGDELLFVFGYCFGNGHIKVEGELSKEEQ 1009

  Fly   629 QVKNRMVRMWTNFAKYGSP 647
            ::....:..|.|||:.|:|
Zfish  1010 ELCKTTMAYWGNFARTGNP 1028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10175NP_001287487.1 COesterase 157..695 CDD:278561 168/532 (32%)
ces2bXP_021326380.1 COesterase 27..539 CDD:306613 9/42 (21%)
COesterase 553..1065 CDD:306613 170/538 (32%)
COesterase 1079..1592 CDD:306613
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100080
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.