DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10175 and CG4382

DIOPT Version :9

Sequence 1:NP_001287487.1 Gene:CG10175 / 42773 FlyBaseID:FBgn0039084 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster


Alignment Length:589 Identity:190/589 - (32%)
Similarity:293/589 - (49%) Gaps:44/589 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LTSHPNSLVQLLPSRAMRVVQEVVRSLRKEREIVATTSLGKVRGRYQKYRSGERGGYYSFKGMRY 186
            |.|..||...|  |:|:...::.:.|.::..::|.||:|||:||.....:||.  .:|:|:|:.|
  Fly    14 LASGQNSDEDL--SKAIPDEEDPIGSNKELSDLVITTALGKIRGTILPSQSGR--NFYAFRGIPY 74

  Fly   187 GAPPTGARRFRAAEPEKPWSGIRDASREGQSCPHKNMILDTFKGD--EDCLFVNVFTTQMPKDDE 249
            ..||....||:..||.:.|....||:.:|..||...::    .||  ||||.||::|.::|  .|
  Fly    75 AKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQLGLV----SGDVSEDCLRVNIYTKELP--SE 133

  Fly   250 SAEQPKLPVMVWLHGGGFSFGSGNSFLY-GPDYLVAEDIVLVTLNYRLGPLGFLTAGP-DAPGNQ 312
            |....:.||:|::|.|||...||.|..: ||.|.:...:||||.|||||.||||..|. :||||.
  Fly   134 SQPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNM 198

  Fly   313 GLKDQVLALKWVRDNIAAFGGDPNQVTIFGESAGASSVQLLLLSSQAKGLFHRAISQSGSALNPW 377
            ||||||..|:||:.:|:.|||||:.:|:.|..|||.:|.|.::|..::||||:||..||:....|
  Fly   199 GLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQW 263

  Fly   378 SMSASSSQRAARLAANLGYVGANKTEDILDFLRRVPAMKLVEAAPTTITAEDQRNNIGLPFVPVV 442
            |:.......|.:.|..|.....|.|| ::|.|:....::.....|...  |..|||..:.:.||:
  Fly   264 SLPDHQMDVATKQATLLHCHTENVTE-MMDCLKGKHYLEFANTLPKMF--EFDRNNPLILWKPVI 325

  Fly   443 EGYWNQDSQEEQFYEEPFLTQHPSDMYHSQNFNSDVAYMTGYNTHEAMLFIRRLRKNPQLLSIIE 507
                     |..|.:|.||.:.|...|.:.:| ..|..:||....|.:.....:.::|.|||.:.
  Fly   326 ---------EPDFGQERFLVEEPIRSYQNDDF-MKVPIITGMTKDEFVGPALSILQSPTLLSALN 380

  Fly   508 NDFGRLVPQDLNVTESHDR---VTREIRSFYLGSKHVGI-ESVDEMIALLTDLMFLQGIRRTARN 568
            .:|..|.|.......|..|   :::|:|:.|...|.:.. .|::.:..|.:|.:...||.|..  
  Fly   381 ENFESLAPVFFMYNTSDARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFV-- 443

  Fly   569 HAKFGNAPVYMYRFSFDGSLGLYKRMLGIPRP---GVCHGDELGYLFKFGFFNLSLDPKSMEVQV 630
            |....:..||.||||:.|:    :..:..|..   ||.|.|:|.|||.....:........|.::
  Fly   444 HLAARSTKVYYYRFSYQGA----RSHIYYPEDAPYGVVHHDDLMYLFVEPSISRMFTEDDDEFRM 504

  Fly   631 KNRMVRMWTNFAKYGSPTPDSEDPMLTTKWAPIDPTNVMNSLNYMDISANLAMKTNPEPERQRFW 695
            .:.||||::.||..|.|...::..:...:|.|..    .....|:||..::.::.|...|....|
  Fly   505 VDIMVRMFSAFAYKGDPNKPTDLALRDIRWRPFS----FKKRYYLDIGKHITLEENLNAENYEIW 565

  Fly   696 DEMY 699
            ..::
  Fly   566 KRLF 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10175NP_001287487.1 COesterase 157..695 CDD:278561 180/548 (33%)
CG4382NP_609301.2 COesterase 41..565 CDD:278561 181/554 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
87.960

Return to query results.
Submit another query.