DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10175 and CG30095

DIOPT Version :9

Sequence 1:NP_001287487.1 Gene:CG10175 / 42773 FlyBaseID:FBgn0039084 Length:707 Species:Drosophila melanogaster
Sequence 2:NP_725529.1 Gene:CG30095 / 246453 FlyBaseID:FBgn0050095 Length:214 Species:Drosophila melanogaster


Alignment Length:87 Identity:14/87 - (16%)
Similarity:28/87 - (32%) Gaps:43/87 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 DASREGQSCPHKNMILDTFKGDEDCLFVNVFTTQMPKDDESAEQPKLPVMVWLHGGGFSFGSGNS 274
            ||..:||.|....::|.|                         :|.:||:               
  Fly   141 DAKIQGQRCNCDKLLLST-------------------------EPPVPVV--------------- 165

  Fly   275 FLYGPDYL--VAEDIVLVTLNY 294
             .:..:|:  |:.:.:|.|:.:
  Fly   166 -YFDKNYIGNVSSETILNTIEF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10175NP_001287487.1 COesterase 157..695 CDD:278561 14/87 (16%)
CG30095NP_725529.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.