DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and MYLK3

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_872299.2 Gene:MYLK3 / 91807 HGNCID:29826 Length:819 Species:Homo sapiens


Alignment Length:247 Identity:69/247 - (27%)
Similarity:117/247 - (47%) Gaps:18/247 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KCTVK--------MVNKQTQSNDRGDTYMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDC 230
            :||.|        .:.|...:.||.|...|..::.|| ||.|:|:|....|.:.....|:|::|.
Human   531 RCTEKSTGLPLAAKIIKVKSAKDREDVKNEINIMNQL-SHVNLIQLYDAFESKHSCTLVMEYVDG 594

  Fly   231 N--MQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVA 293
            .  ..::..::..|:|.|.....|.....:.::||..::|.|:||||:|..:.:|    ..:|:.
Human   595 GELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTG----HQIKII 655

  Fly   294 NFDLATYYR-GSKLYVRCGTPCYMAPEMIAMSGYDYQVDSWSLGVTLFYMLCGKMPFASACKNSK 357
            :|.||..|: ..||.|..|||.::|||::......:..|.||:||..:.:|.|..||..  :...
Human   656 DFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPFLG--ETDA 718

  Fly   358 EIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPIAELDKFQFL 409
            |....|::....:..|....:|.||...:..|||.:.|.|:...:..|.::|
Human   719 ETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWL 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 68/245 (28%)
PKc_like 164..403 CDD:304357 67/239 (28%)
MYLK3NP_872299.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..334
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..462
STKc_MLCK3 510..770 CDD:271094 68/245 (28%)
S_TKc 513..770 CDD:214567 68/245 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.