DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and SKS1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_015299.1 Gene:SKS1 / 856081 SGDID:S000005947 Length:502 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:62/254 - (24%)
Similarity:102/254 - (40%) Gaps:58/254 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 YMEAEVLRQLQSHPNIIELMYTVEDERYMYTVLEHLDCNM------QKVIQKRGILSEADARSVM 251
            |.|.....::|||.||:::...:|.....:.|:::.|.::      .|.....|||    .:.|.
Yeast   107 YREIAFQLRVQSHGNIVKIHQVLESSIATFIVMDYYDRDLFTSIVDDKHFVNHGIL----IKKVF 167

  Fly   252 RCTVSALAHMHQLQVIHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYM 316
            ....|||.|.|:|.:.|.||||||:|:..:...:      :.:|.|:|..:.....|..|:..||
Yeast   168 LQLCSALDHCHRLGIYHCDIKPENVLLDRNDNAY------LCDFGLSTKSKYLAPNVCVGSSYYM 226

  Fly   317 APEMI------AMSGYDYQV----------DSWSLGVTLFYMLCGKMPFASACKN---------- 355
            |||.|      ..:|.....          |.||||:.|..:.|.:.|:..|.:.          
Yeast   227 APERILYCLNTTTNGIHVDECCSSLPTDTGDIWSLGIILINLTCIRNPWLKAHQKEDNTFQHFAN 291

  Fly   356 -----------SKEIYAA---IMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSYRVPI 400
                       |.|::..   |:...|....||:::||..::  :.......|..:|||
Yeast   292 DNNVLKKILPISDELFTVLTKILQLNPYTRIDMKTLMSEVSS--LTSFTREGPLSQVPI 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 62/254 (24%)
PKc_like 164..403 CDD:304357 62/254 (24%)
SKS1NP_015299.1 PKc_like 9..331 CDD:419665 58/233 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345250
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.