DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and NPR1

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_014216.1 Gene:NPR1 / 855538 SGDID:S000005127 Length:790 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:49/210 - (23%)
Similarity:97/210 - (46%) Gaps:25/210 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SHPNIIELMYTVEDERYMYTVLEHLDCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQVIH 268
            :||||||.:..|.:...:..|:|:.:.::..::.... :|..:.....:..::.:.::|.:.:.|
Yeast   496 NHPNIIETIEIVYENDRILQVMEYCEYDLFAIVMSNK-MSYEEICCCFKQILTGVQYLHSIGLAH 559

  Fly   269 RDIKPENLLVCSSSGKWNFKMVKVANFDLATY--YRGSKLYVRC----GTPCYMAPEMIAMSGYD 327
            ||:|.:|.:: :..|     :||:.:|..|..  |..||..|..    |:..|:|||:...:.||
Yeast   560 RDLKLDNCVI-NEKG-----IVKLIDFGAAVVFSYPFSKNLVEASGIVGSDPYLAPEVCIFAKYD 618

  Fly   328 YQ-VDSWSLGVTLFYMLCGKMPF--ASACKNSKEIY---------AAIMSGGPTYPKDMESVMSP 380
            .: ||.||..:....|:..|.|:  .....||.:::         :::::..|..|...||..:.
Yeast   619 PRPVDIWSSAIIFACMILKKFPWKIPKLRDNSFKLFCSGRDCDSLSSLVTRTPDPPSYDESHSTE 683

  Fly   381 EATQLIDGLLVSDPS 395
            :.........||||:
Yeast   684 KKKPESSSNNVSDPN 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 49/210 (23%)
PKc_like 164..403 CDD:304357 49/210 (23%)
NPR1NP_014216.1 PKc_like 451..742 CDD:419665 49/210 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.