DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10177 and DCLK3

DIOPT Version :9

Sequence 1:NP_651150.1 Gene:CG10177 / 42772 FlyBaseID:FBgn0039083 Length:411 Species:Drosophila melanogaster
Sequence 2:NP_001381601.1 Gene:DCLK3 / 85443 HGNCID:19005 Length:817 Species:Homo sapiens


Alignment Length:261 Identity:81/261 - (31%)
Similarity:134/261 - (51%) Gaps:19/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IQLYIETIEPVEHNTRTLIYRGQTRANRTKCTVKMVNKQTQSNDRG-DTYMEAEVL-RQLQSHPN 207
            ::.:.||...:......::...:.|..|....:|:::|   |..:| :..:::|:| .|..||||
Human   521 VEKHYETGRVIGDGNFAVVKECRHRETRQAYAMKIIDK---SRLKGKEDMVDSEILIIQSLSHPN 582

  Fly   208 IIELMYTVEDERYMYTVLEHL------DCNMQKVIQKRGILSEADARSVMRCTVSALAHMHQLQV 266
            |::|....|.:..:|.:||::      |..::.|     ...|.||..::.....||.|||...:
Human   583 IVKLHEVYETDMEIYLILEYVQGGDLFDAIIESV-----KFPEPDAALMIMDLCKALVHMHDKSI 642

  Fly   267 IHRDIKPENLLVCSSSGKWNFKMVKVANFDLATYYRGSKLYVRCGTPCYMAPEMIAMSGYDYQVD 331
            :|||:|||||||..:..|  ...:|:|:|.||.:. ...::..||||.|:|||:::..||..:||
Human   643 VHRDLKPENLLVQRNEDK--STTLKLADFGLAKHV-VRPIFTVCGTPTYVAPEILSEKGYGLEVD 704

  Fly   332 SWSLGVTLFYMLCGKMPFASACKNSKEIYAAIMSGGPTYPKDMESVMSPEATQLIDGLLVSDPSY 396
            .|:.||.|:.:|||..||.|..::..|::..|..|...:.......:|..|..|:..|||.||..
Human   705 MWAAGVILYILLCGFPPFRSPERDQDELFNIIQLGHFEFLPPYWDNISDAAKDLVSRLLVVDPKK 769

  Fly   397 R 397
            |
Human   770 R 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10177NP_651150.1 DCX 18..108 CDD:214711
S_TKc 164..409 CDD:214567 79/242 (33%)
PKc_like 164..403 CDD:304357 79/242 (33%)
DCLK3NP_001381601.1 DCX_DCLK3 93..177 CDD:340528
STKc_DCKL3 524..781 CDD:271087 81/258 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.